Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 4764283..4764895 | Replicon | chromosome |
| Accession | NZ_CP119127 | ||
| Organism | Sphingobium sp. WTD-1 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | N6H05_RS23640 | Protein ID | WP_284111933.1 |
| Coordinates | 4764605..4764895 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | A0A085KAU2 |
| Locus tag | N6H05_RS23635 | Protein ID | WP_037506112.1 |
| Coordinates | 4764283..4764570 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N6H05_RS23615 (N6H05_23615) | 4759553..4760359 | - | 807 | WP_007713350.1 | LytTR family DNA-binding domain-containing protein | - |
| N6H05_RS23620 (N6H05_23620) | 4760356..4761462 | - | 1107 | WP_284111931.1 | histidine kinase | - |
| N6H05_RS23625 (N6H05_23625) | 4761518..4762000 | - | 483 | WP_010336740.1 | helix-turn-helix domain-containing protein | - |
| N6H05_RS23630 (N6H05_23630) | 4762122..4764227 | + | 2106 | WP_284111932.1 | bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase | - |
| N6H05_RS23635 (N6H05_23635) | 4764283..4764570 | - | 288 | WP_037506112.1 | putative addiction module antidote protein | Antitoxin |
| N6H05_RS23640 (N6H05_23640) | 4764605..4764895 | - | 291 | WP_284111933.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N6H05_RS23645 (N6H05_23645) | 4765269..4765784 | + | 516 | WP_284111934.1 | 50S ribosomal protein L10 | - |
| N6H05_RS23650 (N6H05_23650) | 4765857..4766231 | + | 375 | WP_004210471.1 | 50S ribosomal protein L7/L12 | - |
| N6H05_RS23655 (N6H05_23655) | 4766401..4767828 | + | 1428 | WP_284111935.1 | carboxylesterase family protein | - |
| N6H05_RS23660 (N6H05_23660) | 4767838..4769313 | - | 1476 | WP_284111936.1 | porin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10675.39 Da Isoelectric Point: 10.5317
>T273810 WP_284111933.1 NZ_CP119127:c4764895-4764605 [Sphingobium sp. WTD-1]
MEVLQTPVFAEWFAALRDRRARSKIAGRIARFELGLLGDVKSVGDGVLEARVDFGPGYRLYCVRRGDRLIVLLVGGDKSS
QPRDIARAKDMAARID
MEVLQTPVFAEWFAALRDRRARSKIAGRIARFELGLLGDVKSVGDGVLEARVDFGPGYRLYCVRRGDRLIVLLVGGDKSS
QPRDIARAKDMAARID
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|