Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/- |
Location | 3774022..3774467 | Replicon | chromosome |
Accession | NZ_CP119127 | ||
Organism | Sphingobium sp. WTD-1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | N6H05_RS18590 | Protein ID | WP_161731919.1 |
Coordinates | 3774189..3774467 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | N6H05_RS18585 | Protein ID | WP_010336649.1 |
Coordinates | 3774022..3774192 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6H05_RS18575 (N6H05_18575) | 3769299..3772214 | + | 2916 | WP_284111059.1 | excinuclease ABC subunit UvrA | - |
N6H05_RS18580 (N6H05_18580) | 3772327..3773727 | - | 1401 | WP_284111061.1 | reverse transcriptase domain-containing protein | - |
N6H05_RS18585 (N6H05_18585) | 3774022..3774192 | + | 171 | WP_010336649.1 | hypothetical protein | Antitoxin |
N6H05_RS18590 (N6H05_18590) | 3774189..3774467 | + | 279 | WP_161731919.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N6H05_RS18595 (N6H05_18595) | 3774605..3775801 | + | 1197 | WP_284111065.1 | hypothetical protein | - |
N6H05_RS18600 (N6H05_18600) | 3775913..3776128 | + | 216 | WP_037512246.1 | cold-shock protein | - |
N6H05_RS18605 (N6H05_18605) | 3776176..3776778 | - | 603 | WP_037491660.1 | hypothetical protein | - |
N6H05_RS18610 (N6H05_18610) | 3776915..3777121 | + | 207 | WP_004207728.1 | hypothetical protein | - |
N6H05_RS18615 (N6H05_18615) | 3777301..3777684 | + | 384 | WP_284111070.1 | glycine zipper 2TM domain-containing protein | - |
N6H05_RS18620 (N6H05_18620) | 3777742..3778674 | - | 933 | WP_284111072.1 | FAD-binding protein | - |
N6H05_RS18625 (N6H05_18625) | 3778671..3779420 | - | 750 | WP_279776230.1 | electron transfer flavoprotein subunit beta/FixA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10439.93 Da Isoelectric Point: 6.9872
>T273809 WP_161731919.1 NZ_CP119127:3774189-3774467 [Sphingobium sp. WTD-1]
MTLPVVWDDEAETALLTILDYIGPRNKTAAERLYAAIRHTADNLPNHPYAHRPGRTPGTREAVVHPNYILIYRVGIEAIE
ILTLVHARQQYP
MTLPVVWDDEAETALLTILDYIGPRNKTAAERLYAAIRHTADNLPNHPYAHRPGRTPGTREAVVHPNYILIYRVGIEAIE
ILTLVHARQQYP
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|