Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-VagC |
| Location | 3582618..3583256 | Replicon | chromosome |
| Accession | NZ_CP119127 | ||
| Organism | Sphingobium sp. WTD-1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | N6H05_RS17690 | Protein ID | WP_048938827.1 |
| Coordinates | 3582618..3583019 (-) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A0J9FLQ9 |
| Locus tag | N6H05_RS17695 | Protein ID | WP_010338822.1 |
| Coordinates | 3583023..3583256 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N6H05_RS17665 (N6H05_17665) | 3578536..3578700 | + | 165 | WP_199909654.1 | hypothetical protein | - |
| N6H05_RS17670 (N6H05_17670) | 3578793..3579725 | - | 933 | WP_284110895.1 | hypothetical protein | - |
| N6H05_RS17675 (N6H05_17675) | 3579892..3580353 | - | 462 | WP_284110897.1 | hypothetical protein | - |
| N6H05_RS17680 (N6H05_17680) | 3580488..3581042 | - | 555 | WP_234415540.1 | hypothetical protein | - |
| N6H05_RS17685 (N6H05_17685) | 3581164..3582426 | - | 1263 | WP_284110899.1 | hypothetical protein | - |
| N6H05_RS17690 (N6H05_17690) | 3582618..3583019 | - | 402 | WP_048938827.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N6H05_RS17695 (N6H05_17695) | 3583023..3583256 | - | 234 | WP_010338822.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| N6H05_RS17700 (N6H05_17700) | 3583292..3584101 | - | 810 | WP_048938828.1 | PRTRC system ThiF family protein | - |
| N6H05_RS17705 (N6H05_17705) | 3584091..3584750 | - | 660 | WP_279727987.1 | PRTRC system protein A | - |
| N6H05_RS17710 (N6H05_17710) | 3584747..3585577 | - | 831 | WP_048938830.1 | PRTRC system protein B | - |
| N6H05_RS17715 (N6H05_17715) | 3585526..3586701 | - | 1176 | WP_279727988.1 | hypothetical protein | - |
| N6H05_RS17720 (N6H05_17720) | 3586789..3586995 | - | 207 | WP_279727989.1 | PRTRC system protein C | - |
| N6H05_RS17725 (N6H05_17725) | 3587049..3587480 | - | 432 | WP_279727990.1 | PRTRC system protein E | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14437.62 Da Isoelectric Point: 4.7363
>T273808 WP_048938827.1 NZ_CP119127:c3583019-3582618 [Sphingobium sp. WTD-1]
MFLLDTNILSDLIRQPDGMVAHAIADVGEDAVATSIIVAGELRYGAEKRGSPRLKSKIEDLLSLIAVLPLKDDADACYGR
LRADLERRGTPIGANDMLIAAHALAIGATLVTDNIREFERVDGLQLVNWLRTT
MFLLDTNILSDLIRQPDGMVAHAIADVGEDAVATSIIVAGELRYGAEKRGSPRLKSKIEDLLSLIAVLPLKDDADACYGR
LRADLERRGTPIGANDMLIAAHALAIGATLVTDNIREFERVDGLQLVNWLRTT
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|