Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-VagC |
| Location | 3582618..3583256 | Replicon | chromosome |
| Accession | NZ_CP119127 | ||
| Organism | Sphingobium sp. WTD-1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | N6H05_RS17690 | Protein ID | WP_048938827.1 |
| Coordinates | 3582618..3583019 (-) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A0J9FLQ9 |
| Locus tag | N6H05_RS17695 | Protein ID | WP_010338822.1 |
| Coordinates | 3583023..3583256 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - | 3582618..3583019 | - | 402 | - | - | Toxin |
| - | 3583023..3583256 | - | 234 | - | - | Antitoxin |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14437.62 Da Isoelectric Point: 4.7363
>T273808 WP_048938827.1 NZ_CP119127:c3583019-3582618 [Sphingobium sp. WTD-1]
MFLLDTNILSDLIRQPDGMVAHAIADVGEDAVATSIIVAGELRYGAEKRGSPRLKSKIEDLLSLIAVLPLKDDADACYGR
LRADLERRGTPIGANDMLIAAHALAIGATLVTDNIREFERVDGLQLVNWLRTT
MFLLDTNILSDLIRQPDGMVAHAIADVGEDAVATSIIVAGELRYGAEKRGSPRLKSKIEDLLSLIAVLPLKDDADACYGR
LRADLERRGTPIGANDMLIAAHALAIGATLVTDNIREFERVDGLQLVNWLRTT
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|