Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1-VagC
Location 3582618..3583256 Replicon chromosome
Accession NZ_CP119127
Organism Sphingobium sp. WTD-1

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag N6H05_RS17690 Protein ID WP_048938827.1
Coordinates 3582618..3583019 (-) Length 134 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A0J9FLQ9
Locus tag N6H05_RS17695 Protein ID WP_010338822.1
Coordinates 3583023..3583256 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N6H05_RS17665 (N6H05_17665) 3578536..3578700 + 165 WP_199909654.1 hypothetical protein -
N6H05_RS17670 (N6H05_17670) 3578793..3579725 - 933 WP_284110895.1 hypothetical protein -
N6H05_RS17675 (N6H05_17675) 3579892..3580353 - 462 WP_284110897.1 hypothetical protein -
N6H05_RS17680 (N6H05_17680) 3580488..3581042 - 555 WP_234415540.1 hypothetical protein -
N6H05_RS17685 (N6H05_17685) 3581164..3582426 - 1263 WP_284110899.1 hypothetical protein -
N6H05_RS17690 (N6H05_17690) 3582618..3583019 - 402 WP_048938827.1 type II toxin-antitoxin system VapC family toxin Toxin
N6H05_RS17695 (N6H05_17695) 3583023..3583256 - 234 WP_010338822.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
N6H05_RS17700 (N6H05_17700) 3583292..3584101 - 810 WP_048938828.1 PRTRC system ThiF family protein -
N6H05_RS17705 (N6H05_17705) 3584091..3584750 - 660 WP_279727987.1 PRTRC system protein A -
N6H05_RS17710 (N6H05_17710) 3584747..3585577 - 831 WP_048938830.1 PRTRC system protein B -
N6H05_RS17715 (N6H05_17715) 3585526..3586701 - 1176 WP_279727988.1 hypothetical protein -
N6H05_RS17720 (N6H05_17720) 3586789..3586995 - 207 WP_279727989.1 PRTRC system protein C -
N6H05_RS17725 (N6H05_17725) 3587049..3587480 - 432 WP_279727990.1 PRTRC system protein E -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(3-123)

Antitoxin

SpoVT-AbrB domain

(10-55)


Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 14437.62 Da        Isoelectric Point: 4.7363

>T273808 WP_048938827.1 NZ_CP119127:c3583019-3582618 [Sphingobium sp. WTD-1]
MFLLDTNILSDLIRQPDGMVAHAIADVGEDAVATSIIVAGELRYGAEKRGSPRLKSKIEDLLSLIAVLPLKDDADACYGR
LRADLERRGTPIGANDMLIAAHALAIGATLVTDNIREFERVDGLQLVNWLRTT

Download         Length: 402 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8809.19 Da        Isoelectric Point: 4.8723

>AT273808 WP_010338822.1 NZ_CP119127:c3583256-3583023 [Sphingobium sp. WTD-1]
MNLERHVKLFKNGRSQAVRIPREFELPGEDAIIRKEGSRLIIEPARPRSLLAVLKTWEPLDEEIGPIEDLPAEPVDI

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0J9FLQ9

References