Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 2331500..2332040 | Replicon | chromosome |
Accession | NZ_CP119127 | ||
Organism | Sphingobium sp. WTD-1 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | N6H05_RS11640 | Protein ID | WP_284113981.1 |
Coordinates | 2331750..2332040 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | N6H05_RS11635 | Protein ID | WP_169860129.1 |
Coordinates | 2331500..2331736 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6H05_RS11615 (N6H05_11615) | 2326723..2327571 | + | 849 | WP_010335536.1 | ferredoxin--NADP reductase | - |
N6H05_RS11620 (N6H05_11620) | 2327740..2329575 | - | 1836 | WP_284113977.1 | DUF885 family protein | - |
N6H05_RS11625 (N6H05_11625) | 2329714..2330208 | - | 495 | WP_284113978.1 | hypothetical protein | - |
N6H05_RS11630 (N6H05_11630) | 2330294..2331250 | - | 957 | WP_284113979.1 | hypothetical protein | - |
N6H05_RS11635 (N6H05_11635) | 2331500..2331736 | + | 237 | WP_169860129.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
N6H05_RS11640 (N6H05_11640) | 2331750..2332040 | + | 291 | WP_284113981.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N6H05_RS11645 (N6H05_11645) | 2332180..2332626 | - | 447 | WP_284113982.1 | NfeD family protein | - |
N6H05_RS11650 (N6H05_11650) | 2333153..2334124 | - | 972 | WP_284113983.1 | SPFH domain-containing protein | - |
N6H05_RS11655 (N6H05_11655) | 2334202..2335017 | + | 816 | WP_284114216.1 | CoA ester lyase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10602.02 Da Isoelectric Point: 8.0670
>T273807 WP_284113981.1 NZ_CP119127:2331750-2332040 [Sphingobium sp. WTD-1]
VKRLLFTPAAQAELSDIWDYSAATWGVDQADLYIDAIRDVCLALADGRRPGLPVDVRPGYRKASAGSHMIYYRNGGDHLA
IVRVLHGRQDTGRHLA
VKRLLFTPAAQAELSDIWDYSAATWGVDQADLYIDAIRDVCLALADGRRPGLPVDVRPGYRKASAGSHMIYYRNGGDHLA
IVRVLHGRQDTGRHLA
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|