Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 299856..300471 Replicon chromosome
Accession NZ_CP119127
Organism Sphingobium sp. WTD-1

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag N6H05_RS01505 Protein ID WP_284112432.1
Coordinates 300289..300471 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicA Uniprot ID -
Locus tag N6H05_RS01500 Protein ID WP_284112431.1
Coordinates 299856..300248 (-) Length 131 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N6H05_RS01455 (N6H05_01455) 294978..295346 - 369 WP_284112420.1 ogr/Delta-like zinc finger family protein -
N6H05_RS01460 (N6H05_01460) 295343..295801 - 459 WP_284112421.1 hypothetical protein -
N6H05_RS01465 (N6H05_01465) 295798..296076 - 279 WP_284112422.1 hypothetical protein -
N6H05_RS01470 (N6H05_01470) 296073..296417 - 345 WP_284112423.1 YdaS family helix-turn-helix protein -
N6H05_RS01475 (N6H05_01475) 296416..297168 + 753 WP_284112425.1 S24 family peptidase -
N6H05_RS01480 (N6H05_01480) 297171..297590 + 420 WP_284112427.1 HIRAN domain-containing protein -
N6H05_RS01485 (N6H05_01485) 297616..298335 + 720 WP_284112428.1 hypothetical protein -
N6H05_RS01490 (N6H05_01490) 298332..299321 - 990 WP_284112429.1 contractile injection system protein, VgrG/Pvc8 family -
N6H05_RS01495 (N6H05_01495) 299318..299725 - 408 WP_284112430.1 phage tail protein -
N6H05_RS01500 (N6H05_01500) 299856..300248 - 393 WP_284112431.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
N6H05_RS01505 (N6H05_01505) 300289..300471 - 183 WP_284112432.1 type II toxin-antitoxin system HicA family toxin Toxin
N6H05_RS01510 (N6H05_01510) 300546..302786 - 2241 WP_284112433.1 phage tail tape measure protein -
N6H05_RS01515 (N6H05_01515) 302786..302917 - 132 WP_284112434.1 GpE family phage tail protein -
N6H05_RS01520 (N6H05_01520) 302917..303270 - 354 WP_284112436.1 phage tail assembly protein -
N6H05_RS01525 (N6H05_01525) 303393..303902 - 510 WP_284112437.1 phage major tail tube protein -
N6H05_RS01530 (N6H05_01530) 303931..305085 - 1155 WP_284112438.1 phage tail sheath subtilisin-like domain-containing protein -
N6H05_RS01535 (N6H05_01535) 305096..305449 - 354 WP_284112439.1 GPW/gp25 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 281490..326012 44522


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(6-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(5-122)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6732.95 Da        Isoelectric Point: 11.2092

>T273805 WP_284112432.1 NZ_CP119127:c300471-300289 [Sphingobium sp. WTD-1]
MERDSKKIVKRLLEEGFEQISVRGSHHKFRKGAVTIIVPHPKKDLPIGTARSIAKAAGWL

Download         Length: 183 bp

Antitoxin


Download         Length: 131 a.a.        Molecular weight: 14305.18 Da        Isoelectric Point: 4.5094

>AT273805 WP_284112431.1 NZ_CP119127:c300248-299856 [Sphingobium sp. WTD-1]
MKYFYALVHKDADSAFGVSFPDLPGCFSAADRQEDVLANAVEALELWFEDADAVDPRPVDQVREAAKDDLADGAFLLAVP
HIVSANKLMRINLSLDRGMLDAIDQAAALRKLTRSAFMTEAARNEIQGRH

Download         Length: 393 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References