Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3889448..3890102 | Replicon | chromosome |
Accession | NZ_CP119120 | ||
Organism | Escherichia coli strain GENOMIC22-004 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | PYZ88_RS18890 | Protein ID | WP_000244777.1 |
Coordinates | 3889448..3889855 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | PYZ88_RS18895 | Protein ID | WP_000354046.1 |
Coordinates | 3889836..3890102 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYZ88_RS18870 (3885405) | 3885405..3887138 | - | 1734 | WP_000813212.1 | single-stranded-DNA-specific exonuclease RecJ | - |
PYZ88_RS18875 (3887144) | 3887144..3887854 | - | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PYZ88_RS18880 (3887879) | 3887879..3888775 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
PYZ88_RS18885 (3888887) | 3888887..3889408 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
PYZ88_RS18890 (3889448) | 3889448..3889855 | - | 408 | WP_000244777.1 | protein YgfX | Toxin |
PYZ88_RS18895 (3889836) | 3889836..3890102 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
PYZ88_RS18900 (3890345) | 3890345..3891325 | + | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
PYZ88_RS18905 (3891402) | 3891402..3892061 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
PYZ88_RS18910 (3892225) | 3892225..3892536 | - | 312 | WP_001679467.1 | N(4)-acetylcytidine aminohydrolase | - |
PYZ88_RS18915 (3892581) | 3892581..3894014 | + | 1434 | WP_001363803.1 | 6-phospho-beta-glucosidase BglA | - |
PYZ88_RS18920 (3894071) | 3894071..3894814 | - | 744 | Protein_3679 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T273793 WP_000244777.1 NZ_CP119120:c3889855-3889448 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |