Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3448208..3448833 | Replicon | chromosome |
Accession | NZ_CP119120 | ||
Organism | Escherichia coli strain GENOMIC22-004 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PYZ88_RS16780 | Protein ID | WP_000911330.1 |
Coordinates | 3448208..3448606 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | PYZ88_RS16785 | Protein ID | WP_000450524.1 |
Coordinates | 3448606..3448833 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYZ88_RS16760 (3444086) | 3444086..3444286 | + | 201 | WP_000383836.1 | YpfN family protein | - |
PYZ88_RS16765 (3444396) | 3444396..3445094 | - | 699 | WP_000679823.1 | esterase | - |
PYZ88_RS16770 (3445168) | 3445168..3447183 | - | 2016 | WP_000829323.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
PYZ88_RS16775 (3447198) | 3447198..3448061 | - | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
PYZ88_RS16780 (3448208) | 3448208..3448606 | - | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PYZ88_RS16785 (3448606) | 3448606..3448833 | - | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
PYZ88_RS16790 (3448987) | 3448987..3449700 | - | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
PYZ88_RS16795 (3449913) | 3449913..3450947 | - | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
PYZ88_RS16800 (3450964) | 3450964..3451842 | - | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
PYZ88_RS16805 (3451988) | 3451988..3452560 | + | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
PYZ88_RS16810 (3452560) | 3452560..3453030 | + | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T273790 WP_000911330.1 NZ_CP119120:c3448606-3448208 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|