Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2923033..2923865 | Replicon | chromosome |
| Accession | NZ_CP119120 | ||
| Organism | Escherichia coli strain GENOMIC22-004 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0Q2Y5N3 |
| Locus tag | PYZ88_RS14345 | Protein ID | WP_001514886.1 |
| Coordinates | 2923491..2923865 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A7U9IW59 |
| Locus tag | PYZ88_RS14340 | Protein ID | WP_001360327.1 |
| Coordinates | 2923033..2923401 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYZ88_RS14315 (2920148) | 2920148..2920343 | + | 196 | Protein_2780 | DUF905 family protein | - |
| PYZ88_RS14320 (2920461) | 2920461..2921279 | + | 819 | WP_001234653.1 | DUF932 domain-containing protein | - |
| PYZ88_RS14325 (2921621) | 2921621..2922094 | + | 474 | WP_000855059.1 | antirestriction protein | - |
| PYZ88_RS14330 (2922110) | 2922110..2922586 | + | 477 | WP_001186774.1 | RadC family protein | - |
| PYZ88_RS14335 (2922649) | 2922649..2922870 | + | 222 | WP_000692286.1 | DUF987 domain-containing protein | - |
| PYZ88_RS14340 (2923033) | 2923033..2923401 | + | 369 | WP_001360327.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PYZ88_RS14345 (2923491) | 2923491..2923865 | + | 375 | WP_001514886.1 | TA system toxin CbtA family protein | Toxin |
| PYZ88_RS14350 (2923862) | 2923862..2924014 | + | 153 | Protein_2787 | DUF5983 family protein | - |
| PYZ88_RS14355 (2924263) | 2924263..2925804 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| PYZ88_RS14360 (2925819) | 2925819..2926565 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| PYZ88_RS14365 (2926702) | 2926702..2926782 | + | 81 | Protein_2790 | hypothetical protein | - |
| PYZ88_RS14370 (2927598) | 2927598..2927969 | + | 372 | WP_001295631.1 | IS110 family transposase | - |
| PYZ88_RS14375 (2928339) | 2928339..2928605 | + | 267 | WP_063121129.1 | EutP/PduV family microcompartment system protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13930.91 Da Isoelectric Point: 7.2909
>T273788 WP_001514886.1 NZ_CP119120:2923491-2923865 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13593.34 Da Isoelectric Point: 5.9598
>AT273788 WP_001360327.1 NZ_CP119120:2923033-2923401 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0Q2Y5N3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9IW59 |