Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1238694..1239312 | Replicon | chromosome |
Accession | NZ_CP119120 | ||
Organism | Escherichia coli strain GENOMIC22-004 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | PYZ88_RS06015 | Protein ID | WP_001291435.1 |
Coordinates | 1238694..1238912 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | PYZ88_RS06020 | Protein ID | WP_000344800.1 |
Coordinates | 1238938..1239312 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYZ88_RS05980 (1233983) | 1233983..1234555 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
PYZ88_RS05985 (1234586) | 1234586..1234897 | - | 312 | WP_000409911.1 | MGMT family protein | - |
PYZ88_RS05995 (1235276) | 1235276..1235629 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
PYZ88_RS06000 (1235671) | 1235671..1237221 | - | 1551 | WP_001372022.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
PYZ88_RS06005 (1237385) | 1237385..1237855 | - | 471 | WP_000136192.1 | YlaC family protein | - |
PYZ88_RS06010 (1237971) | 1237971..1238522 | - | 552 | WP_000102568.1 | maltose O-acetyltransferase | - |
PYZ88_RS06015 (1238694) | 1238694..1238912 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
PYZ88_RS06020 (1238938) | 1238938..1239312 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
PYZ88_RS06025 (1239858) | 1239858..1243007 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
PYZ88_RS06030 (1243030) | 1243030..1244223 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T273782 WP_001291435.1 NZ_CP119120:c1238912-1238694 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT273782 WP_000344800.1 NZ_CP119120:c1239312-1238938 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |