Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 455526..456361 Replicon chromosome
Accession NZ_CP119120
Organism Escherichia coli strain GENOMIC22-004

Toxin (Protein)


Gene name yeeV Uniprot ID S1PMM7
Locus tag PYZ88_RS02120 Protein ID WP_000854720.1
Coordinates 455526..455903 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A3B7PDS8
Locus tag PYZ88_RS02125 Protein ID WP_001285612.1
Coordinates 455993..456361 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PYZ88_RS02090 (450794) 450794..452332 - 1539 WP_001187182.1 lysine decarboxylation/transport transcriptional activator CadC -
PYZ88_RS02095 (453215) 453215..453541 - 327 WP_000779482.1 type II toxin-antitoxin system RelE/ParE family toxin -
PYZ88_RS02100 (453538) 453538..453801 - 264 WP_001143297.1 type II toxin-antitoxin system ParD family antitoxin -
PYZ88_RS02105 (453873) 453873..454739 - 867 WP_001290180.1 DUF4942 domain-containing protein -
PYZ88_RS02110 (454832) 454832..455029 - 198 WP_000839238.1 DUF957 domain-containing protein -
PYZ88_RS02115 (455041) 455041..455529 - 489 WP_000777672.1 DUF5983 family protein -
PYZ88_RS02120 (455526) 455526..455903 - 378 WP_000854720.1 TA system toxin CbtA family protein Toxin
PYZ88_RS02125 (455993) 455993..456361 - 369 WP_001285612.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
PYZ88_RS02130 (456441) 456441..456662 - 222 WP_000692347.1 DUF987 domain-containing protein -
PYZ88_RS02135 (456749) 456749..457225 - 477 WP_001747787.1 RadC family protein -
PYZ88_RS02140 (457241) 457241..457726 - 486 WP_000849596.1 antirestriction protein -
PYZ88_RS02145 (457781) 457781..458599 - 819 WP_047938428.1 DUF932 domain-containing protein -
PYZ88_RS02150 (458699) 458699..458932 - 234 WP_024173997.1 DUF905 family protein -
PYZ88_RS02155 (459018) 459018..459422 + 405 WP_000839179.1 transposase -
PYZ88_RS02160 (459419) 459419..459766 + 348 WP_024173998.1 IS66 family insertion sequence element accessory protein TnpB -
PYZ88_RS02165 (459815) 459815..461353 + 1539 WP_000099193.1 IS66-like element ISEc22 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 443305..457726 14421


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14089.02 Da        Isoelectric Point: 7.9087

>T273781 WP_000854720.1 NZ_CP119120:c455903-455526 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13663.44 Da        Isoelectric Point: 6.0618

>AT273781 WP_001285612.1 NZ_CP119120:c456361-455993 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSN
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FW05

Antitoxin

Source ID Structure
AlphaFold DB A0A3B7PDS8

References