Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2224909..2225438 | Replicon | chromosome |
Accession | NZ_CP119113 | ||
Organism | Staphylococcus aureus strain GENOMIC22-002 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | PXV46_RS11130 | Protein ID | WP_000621175.1 |
Coordinates | 2224909..2225271 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | PXV46_RS11135 | Protein ID | WP_000948331.1 |
Coordinates | 2225268..2225438 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PXV46_RS11110 (PXV46_11110) | 2221887..2222657 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
PXV46_RS11115 (PXV46_11115) | 2222632..2223111 | - | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
PXV46_RS11120 (PXV46_11120) | 2223113..2223439 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
PXV46_RS11125 (PXV46_11125) | 2223558..2224559 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
PXV46_RS11130 (PXV46_11130) | 2224909..2225271 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PXV46_RS11135 (PXV46_11135) | 2225268..2225438 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
PXV46_RS11140 (PXV46_11140) | 2225523..2226671 | - | 1149 | WP_001281139.1 | alanine racemase | - |
PXV46_RS11145 (PXV46_11145) | 2226737..2227096 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
PXV46_RS11150 (PXV46_11150) | 2227100..2227591 | - | 492 | WP_001286980.1 | PH domain-containing protein | - |
PXV46_RS11155 (PXV46_11155) | 2227584..2229161 | - | 1578 | WP_001294650.1 | PH domain-containing protein | - |
PXV46_RS11160 (PXV46_11160) | 2229154..2229633 | - | 480 | WP_001287081.1 | hypothetical protein | - |
PXV46_RS11165 (PXV46_11165) | 2229842..2230402 | - | 561 | WP_001092419.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T273776 WP_000621175.1 NZ_CP119113:c2225271-2224909 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|