273773

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 984607..985083 Replicon chromosome
Accession NZ_CP119113
Organism Staphylococcus aureus strain GENOMIC22-002

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag PXV46_RS04980 Protein ID WP_000052076.1
Coordinates 984607..984795 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag PXV46_RS04985 Protein ID WP_001059690.1
Coordinates 984823..985083 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PXV46_RS04950 (PXV46_04950) 980636..981118 + 483 WP_000824489.1 hypothetical protein -
PXV46_RS04955 (PXV46_04955) 981459..982145 + 687 WP_001574556.1 thermonuclease family protein -
PXV46_RS04960 (PXV46_04960) 982502..982702 + 201 WP_001059082.1 cold-shock protein -
PXV46_RS04965 (PXV46_04965) 983199..983417 - 219 WP_000005881.1 hypothetical protein -
PXV46_RS04970 (PXV46_04970) 983478..983762 - 285 WP_001004403.1 hypothetical protein -
PXV46_RS04975 (PXV46_04975) 983850..984419 - 570 WP_001106655.1 lipoprotein N-acylation protein LnsA -
PXV46_RS04980 (PXV46_04980) 984607..984795 - 189 WP_000052076.1 hypothetical protein Toxin
PXV46_RS04985 (PXV46_04985) 984823..985083 - 261 WP_001059690.1 hypothetical protein Antitoxin
PXV46_RS04990 (PXV46_04990) 985425..985628 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
PXV46_RS04995 (PXV46_04995) 985625..985861 - 237 WP_000368687.1 hypothetical protein -
PXV46_RS05000 (PXV46_05000) 986086..986667 + 582 WP_001140696.1 histidine phosphatase family protein -
PXV46_RS05005 (PXV46_05005) 986740..987357 - 618 WP_000255562.1 LysE/ArgO family amino acid transporter -
PXV46_RS05010 (PXV46_05010) 987506..988000 - 495 WP_000569881.1 GNAT family N-acetyltransferase -
PXV46_RS05015 (PXV46_05015) 988399..988821 - 423 WP_000974452.1 organic hydroperoxide resistance protein -
PXV46_RS05020 (PXV46_05020) 988969..989685 + 717 WP_000150026.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - vWbp 926809..990307 63498


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T273773 WP_000052076.1 NZ_CP119113:c984795-984607 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT273773 WP_001059690.1 NZ_CP119113:c985083-984823 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References