Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /HTH_19(antitoxin) |
| Location | 2618414..2619202 | Replicon | chromosome |
| Accession | NZ_CP119109 | ||
| Organism | Staphylococcus aureus strain GENOMIC22-001 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | A0A2I7Y5B3 |
| Locus tag | PXV45_RS13285 | Protein ID | WP_000525004.1 |
| Coordinates | 2618741..2619202 (+) | Length | 154 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A0E7YIA0 |
| Locus tag | PXV45_RS13280 | Protein ID | WP_000333630.1 |
| Coordinates | 2618414..2618728 (+) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PXV45_RS13220 (2613556) | 2613556..2614722 | - | 1167 | WP_031794996.1 | DUF2800 domain-containing protein | - |
| PXV45_RS13225 (2614719) | 2614719..2615081 | - | 363 | WP_000985976.1 | hypothetical protein | - |
| PXV45_RS13230 (2615096) | 2615096..2615419 | - | 324 | WP_000174994.1 | hypothetical protein | - |
| PXV45_RS13235 (2615498) | 2615498..2615659 | - | 162 | WP_001285948.1 | DUF1270 domain-containing protein | - |
| PXV45_RS13240 (2615672) | 2615672..2615935 | - | 264 | WP_016187436.1 | helix-turn-helix domain-containing protein | - |
| PXV45_RS13245 (2615960) | 2615960..2616175 | - | 216 | WP_001097552.1 | hypothetical protein | - |
| PXV45_RS13250 (2616230) | 2616230..2616595 | + | 366 | WP_016170627.1 | hypothetical protein | - |
| PXV45_RS13255 (2616564) | 2616564..2616809 | - | 246 | WP_001025401.1 | DUF2829 domain-containing protein | - |
| PXV45_RS13260 (2616865) | 2616865..2617074 | + | 210 | WP_000642492.1 | hypothetical protein | - |
| PXV45_RS13265 (2617064) | 2617064..2617207 | - | 144 | WP_000939498.1 | hypothetical protein | - |
| PXV45_RS13270 (2617236) | 2617236..2618012 | - | 777 | WP_001148544.1 | Rha family transcriptional regulator | - |
| PXV45_RS13275 (2618026) | 2618026..2618262 | - | 237 | WP_001121027.1 | helix-turn-helix transcriptional regulator | - |
| PXV45_RS13280 (2618414) | 2618414..2618728 | + | 315 | WP_000333630.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| PXV45_RS13285 (2618741) | 2618741..2619202 | + | 462 | WP_000525004.1 | hypothetical protein | Toxin |
| PXV45_RS13290 (2619220) | 2619220..2619804 | + | 585 | WP_031918390.1 | hypothetical protein | - |
| PXV45_RS13295 (2620035) | 2620035..2620181 | + | 147 | WP_074370993.1 | hypothetical protein | - |
| PXV45_RS13300 (2620178) | 2620178..2620792 | - | 615 | WP_000191466.1 | hypothetical protein | - |
| PXV45_RS13305 (2620918) | 2620918..2622123 | + | 1206 | WP_031795352.1 | tyrosine-type recombinase/integrase | - |
| PXV45_RS13310 (2622217) | 2622217..2624151 | - | 1935 | Protein_2580 | YSIRK domain-containing triacylglycerol lipase Lip2/Geh | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | geh | 2576909..2631367 | 54458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 18074.46 Da Isoelectric Point: 4.6915
>T273768 WP_000525004.1 NZ_CP119109:2618741-2619202 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
Download Length: 462 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2I7Y5B3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E7YIA0 |