Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 2077590..2078066 Replicon chromosome
Accession NZ_CP119109
Organism Staphylococcus aureus strain GENOMIC22-001

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag PXV45_RS10525 Protein ID WP_000052076.1
Coordinates 2077878..2078066 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag PXV45_RS10520 Protein ID WP_001059690.1
Coordinates 2077590..2077850 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PXV45_RS10485 (2072988) 2072988..2073704 - 717 WP_000150026.1 type I 3-dehydroquinate dehydratase -
PXV45_RS10490 (2073852) 2073852..2074274 + 423 WP_074371006.1 organic hydroperoxide resistance protein -
PXV45_RS10495 (2074673) 2074673..2075167 + 495 WP_000569881.1 GNAT family N-acetyltransferase -
PXV45_RS10500 (2075316) 2075316..2075933 + 618 WP_000255562.1 LysE/ArgO family amino acid transporter -
PXV45_RS10505 (2076006) 2076006..2076587 - 582 WP_001140696.1 histidine phosphatase family protein -
PXV45_RS10510 (2076812) 2076812..2077048 + 237 WP_000368687.1 hypothetical protein -
PXV45_RS10515 (2077045) 2077045..2077248 - 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
PXV45_RS10520 (2077590) 2077590..2077850 + 261 WP_001059690.1 hypothetical protein Antitoxin
PXV45_RS10525 (2077878) 2077878..2078066 + 189 WP_000052076.1 hypothetical protein Toxin
PXV45_RS10530 (2078254) 2078254..2078823 + 570 WP_001106655.1 lipoprotein N-acylation protein LnsA -
PXV45_RS10535 (2078911) 2078911..2079195 + 285 WP_001004403.1 hypothetical protein -
PXV45_RS10540 (2079256) 2079256..2079474 + 219 WP_000005881.1 hypothetical protein -
PXV45_RS10545 (2079971) 2079971..2080171 - 201 WP_001059082.1 cold-shock protein -
PXV45_RS10550 (2080528) 2080528..2081214 - 687 WP_001574556.1 thermonuclease family protein -
PXV45_RS10555 (2081555) 2081555..2082037 - 483 WP_000824489.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T273765 WP_000052076.1 NZ_CP119109:2077878-2078066 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT273765 WP_001059690.1 NZ_CP119109:2077590-2077850 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References