Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Xre-MNT/HTH_26(antitoxin) |
Location | 1194031..1195139 | Replicon | chromosome |
Accession | NZ_CP119109 | ||
Organism | Staphylococcus aureus strain GENOMIC22-001 |
Toxin (Protein)
Gene name | MNTss | Uniprot ID | A0A0M4MHJ8 |
Locus tag | PXV45_RS06140 | Protein ID | WP_002303392.1 |
Coordinates | 1194270..1195139 (+) | Length | 290 a.a. |
Antitoxin (Protein)
Gene name | Xress | Uniprot ID | B9DSK1 |
Locus tag | PXV45_RS06135 | Protein ID | WP_002303393.1 |
Coordinates | 1194031..1194255 (+) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PXV45_RS06115 (1189161) | 1189161..1189595 | + | 435 | WP_002325146.1 | hypothetical protein | - |
PXV45_RS06120 (1190038) | 1190038..1191522 | + | 1485 | WP_074371031.1 | ABC-F type ribosomal protection protein Lsa(E) | - |
PXV45_RS06125 (1191576) | 1191576..1192379 | + | 804 | WP_002294514.1 | lincosamide nucleotidyltransferase Lnu(B) | - |
PXV45_RS06130 (1193067) | 1193067..1193888 | + | 822 | Protein_1171 | recombinase zinc beta ribbon domain-containing protein | - |
PXV45_RS06135 (1194031) | 1194031..1194255 | + | 225 | WP_002303393.1 | helix-turn-helix transcriptional regulator | Antitoxin |
PXV45_RS06140 (1194270) | 1194270..1195139 | + | 870 | WP_002303392.1 | nucleotidyltransferase domain-containing protein | Toxin |
PXV45_RS06145 (1195120) | 1195120..1195806 | + | 687 | WP_224103254.1 | class I SAM-dependent methyltransferase | - |
PXV45_RS06150 (1196041) | 1196041..1196187 | + | 147 | Protein_1175 | JAB domain-containing protein | - |
PXV45_RS06155 (1196255) | 1196255..1196539 | + | 285 | WP_000171859.1 | hypothetical protein | - |
PXV45_RS06160 (1196656) | 1196656..1196853 | - | 198 | WP_000025835.1 | hypothetical protein | - |
PXV45_RS06165 (1197013) | 1197013..1197486 | + | 474 | WP_001236734.1 | DUF4930 family protein | - |
PXV45_RS06170 (1197560) | 1197560..1197679 | + | 120 | WP_000840603.1 | hypothetical protein | - |
PXV45_RS06175 (1197877) | 1197877..1198719 | + | 843 | WP_000911033.1 | rod shape-determining protein MreC | - |
PXV45_RS06180 (1198719) | 1198719..1199249 | + | 531 | WP_001259929.1 | rod shape-determining protein MreD | - |
PXV45_RS06185 (1199736) | 1199736..1200044 | + | 309 | WP_000457386.1 | 50S ribosomal protein L21 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | lsa(E) / lnu(B) | - | 1189161..1197486 | 8325 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32807.38 Da Isoelectric Point: 4.7269
>T273764 WP_002303392.1 NZ_CP119109:1194270-1195139 [Staphylococcus aureus]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARSTHTENSDIDIGIYYNSDSFDLTAINQIATELDDENRNNLVVPPGAWGDW
VNGGGWLVINGCHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGAEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARSTHTENSDIDIGIYYNSDSFDLTAINQIATELDDENRNNLVVPPGAWGDW
VNGGGWLVINGCHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGAEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEYKPEKYAE
RVNHIFEVLGLSLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M4MHJ8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M5SHM7 |