Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 981234..982010 | Replicon | chromosome |
Accession | NZ_CP119109 | ||
Organism | Staphylococcus aureus strain GENOMIC22-001 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | PXV45_RS05120 | Protein ID | WP_000031108.1 |
Coordinates | 981858..982010 (+) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | - |
Locus tag | PXV45_RS05115 | Protein ID | WP_074371037.1 |
Coordinates | 981234..981833 (+) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PXV45_RS05095 (977150) | 977150..978607 | + | 1458 | WP_000649908.1 | ABC transporter permease subunit | - |
PXV45_RS05100 (978600) | 978600..979322 | + | 723 | WP_031774878.1 | amino acid ABC transporter ATP-binding protein | - |
PXV45_RS05105 (979473) | 979473..980600 | + | 1128 | WP_000379980.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
PXV45_RS05110 (980605) | 980605..981075 | + | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
PXV45_RS05115 (981234) | 981234..981833 | + | 600 | WP_074371037.1 | glucosamine-6-phosphate isomerase | Antitoxin |
PXV45_RS05120 (981858) | 981858..982010 | + | 153 | WP_000031108.1 | SAS053 family protein | Toxin |
PXV45_RS05125 (982553) | 982553..982948 | + | 396 | WP_000901018.1 | hypothetical protein | - |
PXV45_RS05130 (983144) | 983144..984529 | + | 1386 | WP_000116238.1 | class II fumarate hydratase | - |
PXV45_RS05135 (984984) | 984984..985805 | - | 822 | WP_000669380.1 | RluA family pseudouridine synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T273763 WP_000031108.1 NZ_CP119109:981858-982010 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22355.53 Da Isoelectric Point: 5.1445
>AT273763 WP_074371037.1 NZ_CP119109:981234-981833 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLILQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLILQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|