Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 786708..787237 | Replicon | chromosome |
| Accession | NZ_CP119109 | ||
| Organism | Staphylococcus aureus strain GENOMIC22-001 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | PXV45_RS03915 | Protein ID | WP_000621175.1 |
| Coordinates | 786875..787237 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | PXV45_RS03910 | Protein ID | WP_000948331.1 |
| Coordinates | 786708..786878 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PXV45_RS03880 (781744) | 781744..782304 | + | 561 | WP_001092419.1 | K(+)-transporting ATPase subunit C | - |
| PXV45_RS03885 (782513) | 782513..782992 | + | 480 | WP_001287081.1 | hypothetical protein | - |
| PXV45_RS03890 (782985) | 782985..784562 | + | 1578 | WP_001294650.1 | PH domain-containing protein | - |
| PXV45_RS03895 (784555) | 784555..785046 | + | 492 | WP_001286980.1 | PH domain-containing protein | - |
| PXV45_RS03900 (785050) | 785050..785409 | + | 360 | WP_000581197.1 | holo-ACP synthase | - |
| PXV45_RS03905 (785475) | 785475..786623 | + | 1149 | WP_001281139.1 | alanine racemase | - |
| PXV45_RS03910 (786708) | 786708..786878 | + | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| PXV45_RS03915 (786875) | 786875..787237 | + | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PXV45_RS03920 (787587) | 787587..788588 | + | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| PXV45_RS03925 (788707) | 788707..789033 | + | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| PXV45_RS03930 (789035) | 789035..789514 | + | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
| PXV45_RS03935 (789489) | 789489..790259 | + | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T273759 WP_000621175.1 NZ_CP119109:786875-787237 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|