Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/RHH-MazF |
Location | 3482077..3482669 | Replicon | chromosome |
Accession | NZ_CP119108 | ||
Organism | Microbacterium sp. KACC 23027 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | PU630_RS16525 | Protein ID | WP_275278150.1 |
Coordinates | 3482077..3482445 (-) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | PU630_RS16530 | Protein ID | WP_275278151.1 |
Coordinates | 3482442..3482669 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PU630_RS16505 (PU630_16505) | 3478920..3479801 | - | 882 | WP_275278146.1 | NAD(P)H-binding protein | - |
PU630_RS16510 (PU630_16510) | 3479893..3480450 | + | 558 | WP_275278147.1 | TetR/AcrR family transcriptional regulator | - |
PU630_RS16515 (PU630_16515) | 3480508..3481671 | + | 1164 | WP_275278148.1 | acyl-CoA dehydrogenase family protein | - |
PU630_RS16520 (PU630_16520) | 3481741..3482037 | + | 297 | WP_275278149.1 | DUF503 family protein | - |
PU630_RS16525 (PU630_16525) | 3482077..3482445 | - | 369 | WP_275278150.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PU630_RS16530 (PU630_16530) | 3482442..3482669 | - | 228 | WP_275278151.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
PU630_RS16535 (PU630_16535) | 3482713..3483369 | - | 657 | WP_275278152.1 | GntR family transcriptional regulator | - |
PU630_RS16540 (PU630_16540) | 3483470..3484762 | + | 1293 | WP_275278153.1 | MFS transporter | - |
PU630_RS16545 (PU630_16545) | 3485007..3486281 | + | 1275 | WP_275278154.1 | M18 family aminopeptidase | - |
PU630_RS16550 (PU630_16550) | 3486372..3486863 | + | 492 | WP_275278155.1 | bifunctional nuclease family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 12792.82 Da Isoelectric Point: 10.9753
>T273752 WP_275278150.1 NZ_CP119108:c3482445-3482077 [Microbacterium sp. KACC 23027]
VSGELPFVRRGAIVLVDLDPSDGSEAAKLRPAVVVSNNTANAAALRTGRGVLTVVPVTSNTEKVYPFQVLLPAASTGLSR
DSKAQAEQLRAVSLLRVRRVVGWVPGDLMAGLDAAVRLHLAL
VSGELPFVRRGAIVLVDLDPSDGSEAAKLRPAVVVSNNTANAAALRTGRGVLTVVPVTSNTEKVYPFQVLLPAASTGLSR
DSKAQAEQLRAVSLLRVRRVVGWVPGDLMAGLDAAVRLHLAL
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|