Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 3204310..3204859 | Replicon | chromosome |
| Accession | NZ_CP119108 | ||
| Organism | Microbacterium sp. KACC 23027 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | PU630_RS15175 | Protein ID | WP_275277895.1 |
| Coordinates | 3204310..3204624 (-) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | PU630_RS15180 | Protein ID | WP_275277896.1 |
| Coordinates | 3204626..3204859 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PU630_RS15145 (PU630_15145) | 3199671..3201020 | + | 1350 | WP_275277889.1 | magnesium transporter | - |
| PU630_RS15150 (PU630_15150) | 3201054..3201761 | + | 708 | WP_275277890.1 | hypothetical protein | - |
| PU630_RS15155 (PU630_15155) | 3201790..3202383 | - | 594 | WP_275277891.1 | TetR/AcrR family transcriptional regulator C-terminal domain-containing protein | - |
| PU630_RS15160 (PU630_15160) | 3202438..3203019 | + | 582 | WP_275277892.1 | biotin transporter BioY | - |
| PU630_RS15165 (PU630_15165) | 3203013..3203708 | + | 696 | WP_275277893.1 | ABC transporter ATP-binding protein | - |
| PU630_RS15170 (PU630_15170) | 3203702..3204304 | + | 603 | WP_275277894.1 | energy-coupling factor transporter transmembrane component T | - |
| PU630_RS15175 (PU630_15175) | 3204310..3204624 | - | 315 | WP_275277895.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PU630_RS15180 (PU630_15180) | 3204626..3204859 | - | 234 | WP_275277896.1 | YlcI/YnfO family protein | Antitoxin |
| PU630_RS15185 (PU630_15185) | 3205003..3205740 | + | 738 | WP_275277897.1 | SDR family oxidoreductase | - |
| PU630_RS15190 (PU630_15190) | 3205745..3206344 | + | 600 | WP_275277898.1 | TetR/AcrR family transcriptional regulator | - |
| PU630_RS15195 (PU630_15195) | 3206487..3207689 | - | 1203 | WP_275277899.1 | acyl-CoA dehydrogenase family protein | - |
| PU630_RS15200 (PU630_15200) | 3207689..3208765 | - | 1077 | WP_275277900.1 | phosphotransferase family protein | - |
| PU630_RS15205 (PU630_15205) | 3208840..3209037 | - | 198 | WP_275277901.1 | hypothetical protein | - |
| PU630_RS15210 (PU630_15210) | 3209161..3209598 | - | 438 | WP_275277902.1 | MerR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11071.09 Da Isoelectric Point: 6.9483
>T273751 WP_275277895.1 NZ_CP119108:c3204624-3204310 [Microbacterium sp. KACC 23027]
VREICLARLDKTRPALVLTRDLARAAMTKVTIAPITSTVKGLSSEVALDARNGLDHPCVASLDNIVTIPVAALGRTIGYL
SMEQEVALARAMVLAFDLDIPLMG
VREICLARLDKTRPALVLTRDLARAAMTKVTIAPITSTVKGLSSEVALDARNGLDHPCVASLDNIVTIPVAALGRTIGYL
SMEQEVALARAMVLAFDLDIPLMG
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|