Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF(toxin)
Location 3204310..3204859 Replicon chromosome
Accession NZ_CP119108
Organism Microbacterium sp. KACC 23027

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag PU630_RS15175 Protein ID WP_275277895.1
Coordinates 3204310..3204624 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID -
Locus tag PU630_RS15180 Protein ID WP_275277896.1
Coordinates 3204626..3204859 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PU630_RS15145 (PU630_15145) 3199671..3201020 + 1350 WP_275277889.1 magnesium transporter -
PU630_RS15150 (PU630_15150) 3201054..3201761 + 708 WP_275277890.1 hypothetical protein -
PU630_RS15155 (PU630_15155) 3201790..3202383 - 594 WP_275277891.1 TetR/AcrR family transcriptional regulator C-terminal domain-containing protein -
PU630_RS15160 (PU630_15160) 3202438..3203019 + 582 WP_275277892.1 biotin transporter BioY -
PU630_RS15165 (PU630_15165) 3203013..3203708 + 696 WP_275277893.1 ABC transporter ATP-binding protein -
PU630_RS15170 (PU630_15170) 3203702..3204304 + 603 WP_275277894.1 energy-coupling factor transporter transmembrane component T -
PU630_RS15175 (PU630_15175) 3204310..3204624 - 315 WP_275277895.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
PU630_RS15180 (PU630_15180) 3204626..3204859 - 234 WP_275277896.1 YlcI/YnfO family protein Antitoxin
PU630_RS15185 (PU630_15185) 3205003..3205740 + 738 WP_275277897.1 SDR family oxidoreductase -
PU630_RS15190 (PU630_15190) 3205745..3206344 + 600 WP_275277898.1 TetR/AcrR family transcriptional regulator -
PU630_RS15195 (PU630_15195) 3206487..3207689 - 1203 WP_275277899.1 acyl-CoA dehydrogenase family protein -
PU630_RS15200 (PU630_15200) 3207689..3208765 - 1077 WP_275277900.1 phosphotransferase family protein -
PU630_RS15205 (PU630_15205) 3208840..3209037 - 198 WP_275277901.1 hypothetical protein -
PU630_RS15210 (PU630_15210) 3209161..3209598 - 438 WP_275277902.1 MerR family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(10-98)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11071.09 Da        Isoelectric Point: 6.9483

>T273751 WP_275277895.1 NZ_CP119108:c3204624-3204310 [Microbacterium sp. KACC 23027]
VREICLARLDKTRPALVLTRDLARAAMTKVTIAPITSTVKGLSSEVALDARNGLDHPCVASLDNIVTIPVAALGRTIGYL
SMEQEVALARAMVLAFDLDIPLMG

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8275.32 Da        Isoelectric Point: 4.4079

>AT273751 WP_275277896.1 NZ_CP119108:c3204859-3204626 [Microbacterium sp. KACC 23027]
MSTQIAVRLPDPVVEFLDREVAGGRVASRAALVSSALEREMRRRAAEGDAAVLARVGTADDLDSLVDWTVTHIDLEG

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References