Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | chpK-mazE/PemK(toxin) |
Location | 3117694..3118274 | Replicon | chromosome |
Accession | NZ_CP119108 | ||
Organism | Microbacterium sp. KACC 23027 |
Toxin (Protein)
Gene name | chpK | Uniprot ID | - |
Locus tag | PU630_RS14770 | Protein ID | WP_275280115.1 |
Coordinates | 3117694..3118017 (-) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | PU630_RS14775 | Protein ID | WP_275277818.1 |
Coordinates | 3118035..3118274 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PU630_RS14750 (PU630_14750) | 3113755..3114444 | - | 690 | WP_275277814.1 | TetR/AcrR family transcriptional regulator | - |
PU630_RS14755 (PU630_14755) | 3114626..3116242 | + | 1617 | WP_275277815.1 | FAD-binding oxidoreductase | - |
PU630_RS14760 (PU630_14760) | 3116253..3116672 | + | 420 | WP_275277816.1 | VOC family protein | - |
PU630_RS14765 (PU630_14765) | 3116890..3117657 | + | 768 | WP_275277817.1 | cyclase family protein | - |
PU630_RS14770 (PU630_14770) | 3117694..3118017 | - | 324 | WP_275280115.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PU630_RS14775 (PU630_14775) | 3118035..3118274 | - | 240 | WP_275277818.1 | CopG family transcriptional regulator | Antitoxin |
PU630_RS14780 (PU630_14780) | 3118461..3118754 | + | 294 | WP_275277819.1 | putative quinol monooxygenase | - |
PU630_RS14785 (PU630_14785) | 3118756..3119724 | + | 969 | WP_275277820.1 | fumarylacetoacetate hydrolase family protein | - |
PU630_RS14790 (PU630_14790) | 3119913..3120629 | + | 717 | WP_275277821.1 | IMP cyclohydrolase | - |
PU630_RS14795 (PU630_14795) | 3120661..3121239 | - | 579 | WP_275277822.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 11195.94 Da Isoelectric Point: 4.4013
>T273750 WP_275280115.1 NZ_CP119108:c3118017-3117694 [Microbacterium sp. KACC 23027]
VWVDFGEPRGSEPGKVRPAVILQDDWLLASSIATVVVVPLTSNTRLAAFPGNVLIPSEASGLEKDSVAVVSQIGPVSREY
IVPYPVGALANYLLSDVAAGVRLVIGL
VWVDFGEPRGSEPGKVRPAVILQDDWLLASSIATVVVVPLTSNTRLAAFPGNVLIPSEASGLEKDSVAVVSQIGPVSREY
IVPYPVGALANYLLSDVAAGVRLVIGL
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|