Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 3042622..3043325 | Replicon | chromosome |
Accession | NZ_CP119108 | ||
Organism | Microbacterium sp. KACC 23027 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PU630_RS14410 | Protein ID | WP_275277748.1 |
Coordinates | 3042622..3043026 (-) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PU630_RS14415 | Protein ID | WP_275277749.1 |
Coordinates | 3043023..3043325 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PU630_RS14385 (PU630_14385) | 3037630..3038634 | - | 1005 | WP_275277743.1 | amidohydrolase family protein | - |
PU630_RS14390 (PU630_14390) | 3038631..3039224 | - | 594 | WP_275277744.1 | TetR/AcrR family transcriptional regulator | - |
PU630_RS14395 (PU630_14395) | 3039224..3040342 | - | 1119 | WP_275277745.1 | LLM class flavin-dependent oxidoreductase | - |
PU630_RS14400 (PU630_14400) | 3040371..3041690 | - | 1320 | WP_275277746.1 | MFS transporter | - |
PU630_RS14405 (PU630_14405) | 3041858..3042625 | - | 768 | WP_275277747.1 | IclR family transcriptional regulator C-terminal domain-containing protein | - |
PU630_RS14410 (PU630_14410) | 3042622..3043026 | - | 405 | WP_275277748.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PU630_RS14415 (PU630_14415) | 3043023..3043325 | - | 303 | WP_275277749.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PU630_RS14420 (PU630_14420) | 3043422..3044597 | - | 1176 | WP_275277750.1 | thiolase family protein | - |
PU630_RS14425 (PU630_14425) | 3044600..3045274 | - | 675 | WP_275277751.1 | 3-oxoacid CoA-transferase subunit B | - |
PU630_RS14430 (PU630_14430) | 3045271..3046026 | - | 756 | WP_275277752.1 | 3-oxoacid CoA-transferase subunit A | - |
PU630_RS14435 (PU630_14435) | 3046216..3047439 | + | 1224 | WP_275277753.1 | cobalamin-independent methionine synthase II family protein | - |
PU630_RS14440 (PU630_14440) | 3047864..3048250 | - | 387 | WP_275277754.1 | 4-carboxymuconolactone decarboxylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14284.96 Da Isoelectric Point: 4.3047
>T273749 WP_275277748.1 NZ_CP119108:c3043026-3042622 [Microbacterium sp. KACC 23027]
VIVDTSALIAVMEDEPQGAAIRRLLSDYGGRISAATLVEARMVAFGKGGPAAVRELDGLIRRARLDVAAVDVESADVATG
AFFAYGRGSGHPARLNFGDTFSYALAYIENDPLLYVGDDFSHTDIRSALEEYGE
VIVDTSALIAVMEDEPQGAAIRRLLSDYGGRISAATLVEARMVAFGKGGPAAVRELDGLIRRARLDVAAVDVESADVATG
AFFAYGRGSGHPARLNFGDTFSYALAYIENDPLLYVGDDFSHTDIRSALEEYGE
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|