Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemK-mazE/MazF(toxin) |
| Location | 4510411..4511042 | Replicon | chromosome |
| Accession | NZ_CP119107 | ||
| Organism | Pullulanibacillus sp. KACC 23026 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | PU629_RS20965 | Protein ID | WP_275281956.1 |
| Coordinates | 4510411..4510761 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | PU629_RS20970 | Protein ID | WP_275281957.1 |
| Coordinates | 4510767..4511042 (-) | Length | 92 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PU629_RS20930 (PU629_20930) | 4505959..4506756 | - | 798 | WP_275281949.1 | RNA polymerase sigma factor SigB | - |
| PU629_RS20935 (PU629_20935) | 4506725..4507207 | - | 483 | WP_275281950.1 | anti-sigma B factor RsbW | - |
| PU629_RS20940 (PU629_20940) | 4507204..4507530 | - | 327 | WP_275281951.1 | STAS domain-containing protein | - |
| PU629_RS20945 (PU629_20945) | 4507588..4508595 | - | 1008 | WP_275281952.1 | PP2C family protein-serine/threonine phosphatase | - |
| PU629_RS20950 (PU629_20950) | 4508616..4509017 | - | 402 | WP_275281953.1 | anti-sigma regulatory factor | - |
| PU629_RS20955 (PU629_20955) | 4509017..4509376 | - | 360 | WP_275281954.1 | STAS domain-containing protein | - |
| PU629_RS20960 (PU629_20960) | 4509379..4510209 | - | 831 | WP_275281955.1 | STAS domain-containing protein | - |
| PU629_RS20965 (PU629_20965) | 4510411..4510761 | - | 351 | WP_275281956.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PU629_RS20970 (PU629_20970) | 4510767..4511042 | - | 276 | WP_275281957.1 | antitoxin endoai | Antitoxin |
| PU629_RS20975 (PU629_20975) | 4511159..4512307 | - | 1149 | WP_275281959.1 | alanine racemase | - |
| PU629_RS20980 (PU629_20980) | 4512453..4513454 | - | 1002 | WP_275281960.1 | outer membrane lipoprotein carrier protein LolA | - |
| PU629_RS20985 (PU629_20985) | 4513736..4514101 | - | 366 | WP_275281961.1 | holo-ACP synthase | - |
| PU629_RS20990 (PU629_20990) | 4514254..4514868 | + | 615 | WP_275281962.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12956.99 Da Isoelectric Point: 5.7168
>T273746 WP_275281956.1 NZ_CP119107:c4510761-4510411 [Pullulanibacillus sp. KACC 23026]
VIVKRGDVYFADLSPVVGSEQGGVRPVLIIQNDIGNRFSPTVVVAAITAQIQKAKLPTHIEIDAKRYGFDRDSVILLEQI
RTIDKQRLTDKITHLDEEMMARVNEAIQISLGLIDF
VIVKRGDVYFADLSPVVGSEQGGVRPVLIIQNDIGNRFSPTVVVAAITAQIQKAKLPTHIEIDAKRYGFDRDSVILLEQI
RTIDKQRLTDKITHLDEEMMARVNEAIQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|