Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 4719586..4720248 | Replicon | chromosome |
Accession | NZ_CP119083 | ||
Organism | Telluria chitinolytica strain ACM 3522 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PX653_RS20885 | Protein ID | WP_277414636.1 |
Coordinates | 4719586..4720035 (-) | Length | 150 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PX653_RS20890 | Protein ID | WP_277418626.1 |
Coordinates | 4720042..4720248 (-) | Length | 69 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PX653_RS20870 (PX653_20870) | 4716040..4716486 | - | 447 | WP_277414633.1 | FKBP-type peptidyl-prolyl cis-trans isomerase | - |
PX653_RS20875 (PX653_20875) | 4716607..4718478 | - | 1872 | WP_277414634.1 | potassium transporter Kup | - |
PX653_RS20880 (PX653_20880) | 4718692..4719573 | + | 882 | WP_277414635.1 | EamA family transporter RarD | - |
PX653_RS20885 (PX653_20885) | 4719586..4720035 | - | 450 | WP_277414636.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PX653_RS20890 (PX653_20890) | 4720042..4720248 | - | 207 | WP_277418626.1 | DNA-binding protein | Antitoxin |
PX653_RS20895 (PX653_20895) | 4720427..4722094 | + | 1668 | WP_277414637.1 | energy-dependent translational throttle protein EttA | - |
PX653_RS20900 (PX653_20900) | 4722252..4722845 | - | 594 | WP_277414638.1 | outer membrane beta-barrel protein | - |
PX653_RS20905 (PX653_20905) | 4723157..4723759 | + | 603 | WP_277414639.1 | hypothetical protein | - |
PX653_RS20910 (PX653_20910) | 4723725..4724327 | - | 603 | WP_277414640.1 | alpha-ketoglutarate-dependent dioxygenase AlkB | - |
PX653_RS20915 (PX653_20915) | 4724367..4724945 | + | 579 | WP_277414641.1 | molybdopterin-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 150 a.a. Molecular weight: 16420.69 Da Isoelectric Point: 5.2305
>T273744 WP_277414636.1 NZ_CP119083:c4720035-4719586 [Telluria chitinolytica]
MYLLDTNVISEYRKGARANRGVQAFFAEVQSEALFLPAQVIGEIQAGIARLRRQQDELAVQRAGMYERWLEELLDVFGAR
VLEFDTEAARVWGTLLGNDKHDPHTIDKQIAAIALVHDLVVVTRDGGTAFASLRPVRALDPFSASVAAG
MYLLDTNVISEYRKGARANRGVQAFFAEVQSEALFLPAQVIGEIQAGIARLRRQQDELAVQRAGMYERWLEELLDVFGAR
VLEFDTEAARVWGTLLGNDKHDPHTIDKQIAAIALVHDLVVVTRDGGTAFASLRPVRALDPFSASVAAG
Download Length: 450 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|