Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 2283101..2283707 Replicon chromosome
Accession NZ_CP119082
Organism Paracoccus sp. S3-43

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag PXD02_RS11910 Protein ID WP_275104085.1
Coordinates 2283101..2283289 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag PXD02_RS11915 Protein ID WP_275104086.1
Coordinates 2283312..2283707 (+) Length 132 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PXD02_RS11870 (PXD02_11870) 2278452..2279042 - 591 WP_275104080.1 F0F1 ATP synthase subunit B' -
PXD02_RS11875 (PXD02_11875) 2279119..2279355 - 237 WP_089343169.1 F0F1 ATP synthase subunit C -
PXD02_RS11880 (PXD02_11880) 2279414..2280169 - 756 WP_275104081.1 F0F1 ATP synthase subunit A -
PXD02_RS11885 (PXD02_11885) 2280172..2280519 - 348 WP_275104082.1 AtpZ/AtpI family protein -
PXD02_RS11890 (PXD02_11890) 2280725..2281084 + 360 WP_275106416.1 metalloregulator ArsR/SmtB family transcription factor -
PXD02_RS11895 (PXD02_11895) 2281068..2281949 + 882 WP_275104083.1 PfkB family carbohydrate kinase -
PXD02_RS11900 (PXD02_11900) 2281946..2282863 + 918 WP_275104084.1 pseudouridine-5'-phosphate glycosidase -
PXD02_RS11910 (PXD02_11910) 2283101..2283289 + 189 WP_275104085.1 type II toxin-antitoxin system HicA family toxin Toxin
PXD02_RS11915 (PXD02_11915) 2283312..2283707 + 396 WP_275104086.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
PXD02_RS11920 (PXD02_11920) 2283871..2286957 + 3087 WP_275104087.1 formate dehydrogenase-N subunit alpha -
PXD02_RS11925 (PXD02_11925) 2286954..2287937 + 984 WP_275104088.1 formate dehydrogenase subunit beta -
PXD02_RS11930 (PXD02_11930) 2287937..2288623 + 687 WP_275104089.1 formate dehydrogenase subunit gamma -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(8-61)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-124)


Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7071.32 Da        Isoelectric Point: 10.9252

>T273742 WP_275104085.1 NZ_CP119082:2283101-2283289 [Paracoccus sp. S3-43]
MNLETDSRKIIQMLKAEGFEEVSKRGSHLKLRKGDRTVIVPHPKKNLPVGTVRSIYWQAGLL

Download         Length: 189 bp

Antitoxin


Download         Length: 132 a.a.        Molecular weight: 13993.76 Da        Isoelectric Point: 4.7434

>AT273742 WP_275104086.1 NZ_CP119082:2283312-2283707 [Paracoccus sp. S3-43]
MKLYTAIVHKDAGSAYGLTFPDLPGCHAAADEWDDIPAAAAQALDLWFDDQADVEPSSIEAIRKREDVAISLKEGGSLIT
IPYISADGAPERINVSIERGLLRSIDRTAKARGMTRSAFLAAAARHEVTGA

Download         Length: 396 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References