Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2283101..2283707 | Replicon | chromosome |
| Accession | NZ_CP119082 | ||
| Organism | Paracoccus sp. S3-43 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | PXD02_RS11910 | Protein ID | WP_275104085.1 |
| Coordinates | 2283101..2283289 (+) | Length | 63 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PXD02_RS11915 | Protein ID | WP_275104086.1 |
| Coordinates | 2283312..2283707 (+) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PXD02_RS11870 (PXD02_11870) | 2278452..2279042 | - | 591 | WP_275104080.1 | F0F1 ATP synthase subunit B' | - |
| PXD02_RS11875 (PXD02_11875) | 2279119..2279355 | - | 237 | WP_089343169.1 | F0F1 ATP synthase subunit C | - |
| PXD02_RS11880 (PXD02_11880) | 2279414..2280169 | - | 756 | WP_275104081.1 | F0F1 ATP synthase subunit A | - |
| PXD02_RS11885 (PXD02_11885) | 2280172..2280519 | - | 348 | WP_275104082.1 | AtpZ/AtpI family protein | - |
| PXD02_RS11890 (PXD02_11890) | 2280725..2281084 | + | 360 | WP_275106416.1 | metalloregulator ArsR/SmtB family transcription factor | - |
| PXD02_RS11895 (PXD02_11895) | 2281068..2281949 | + | 882 | WP_275104083.1 | PfkB family carbohydrate kinase | - |
| PXD02_RS11900 (PXD02_11900) | 2281946..2282863 | + | 918 | WP_275104084.1 | pseudouridine-5'-phosphate glycosidase | - |
| PXD02_RS11910 (PXD02_11910) | 2283101..2283289 | + | 189 | WP_275104085.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PXD02_RS11915 (PXD02_11915) | 2283312..2283707 | + | 396 | WP_275104086.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PXD02_RS11920 (PXD02_11920) | 2283871..2286957 | + | 3087 | WP_275104087.1 | formate dehydrogenase-N subunit alpha | - |
| PXD02_RS11925 (PXD02_11925) | 2286954..2287937 | + | 984 | WP_275104088.1 | formate dehydrogenase subunit beta | - |
| PXD02_RS11930 (PXD02_11930) | 2287937..2288623 | + | 687 | WP_275104089.1 | formate dehydrogenase subunit gamma | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 63 a.a. Molecular weight: 7071.32 Da Isoelectric Point: 10.9252
>T273742 WP_275104085.1 NZ_CP119082:2283101-2283289 [Paracoccus sp. S3-43]
MNLETDSRKIIQMLKAEGFEEVSKRGSHLKLRKGDRTVIVPHPKKNLPVGTVRSIYWQAGLL
MNLETDSRKIIQMLKAEGFEEVSKRGSHLKLRKGDRTVIVPHPKKNLPVGTVRSIYWQAGLL
Download Length: 189 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 13993.76 Da Isoelectric Point: 4.7434
>AT273742 WP_275104086.1 NZ_CP119082:2283312-2283707 [Paracoccus sp. S3-43]
MKLYTAIVHKDAGSAYGLTFPDLPGCHAAADEWDDIPAAAAQALDLWFDDQADVEPSSIEAIRKREDVAISLKEGGSLIT
IPYISADGAPERINVSIERGLLRSIDRTAKARGMTRSAFLAAAARHEVTGA
MKLYTAIVHKDAGSAYGLTFPDLPGCHAAADEWDDIPAAAAQALDLWFDDQADVEPSSIEAIRKREDVAISLKEGGSLIT
IPYISADGAPERINVSIERGLLRSIDRTAKARGMTRSAFLAAAARHEVTGA
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|