Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4778512..4779128 | Replicon | chromosome |
Accession | NZ_CP119076 | ||
Organism | Klebsiella aerogenes strain RX7.1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PYR66_RS22650 | Protein ID | WP_275048091.1 |
Coordinates | 4778512..4778886 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PYR66_RS22655 | Protein ID | WP_275050401.1 |
Coordinates | 4778886..4779128 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYR66_RS22635 (PYR66_22635) | 4776013..4776915 | + | 903 | WP_275048088.1 | formate dehydrogenase subunit beta | - |
PYR66_RS22640 (PYR66_22640) | 4776912..4777538 | + | 627 | WP_275048089.1 | formate dehydrogenase cytochrome b556 subunit | - |
PYR66_RS22645 (PYR66_22645) | 4777544..4778473 | + | 930 | WP_275048090.1 | formate dehydrogenase accessory protein FdhE | - |
PYR66_RS22650 (PYR66_22650) | 4778512..4778886 | - | 375 | WP_275048091.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PYR66_RS22655 (PYR66_22655) | 4778886..4779128 | - | 243 | WP_275050401.1 | CopG family transcriptional regulator | Antitoxin |
PYR66_RS22660 (PYR66_22660) | 4779332..4780249 | + | 918 | WP_275048092.1 | alpha/beta hydrolase | - |
PYR66_RS22665 (PYR66_22665) | 4780266..4781207 | - | 942 | WP_275048093.1 | fatty acid biosynthesis protein FabY | - |
PYR66_RS22670 (PYR66_22670) | 4781252..4781689 | - | 438 | WP_275048094.1 | D-aminoacyl-tRNA deacylase | - |
PYR66_RS22675 (PYR66_22675) | 4781686..4782546 | - | 861 | WP_275048095.1 | virulence factor BrkB family protein | - |
PYR66_RS22680 (PYR66_22680) | 4782540..4783139 | - | 600 | WP_275048096.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14247.52 Da Isoelectric Point: 6.2293
>T273740 WP_275048091.1 NZ_CP119076:c4778886-4778512 [Klebsiella aerogenes]
MVKGVALFDTNILIDLFSGRREAQQALEAWPLQNAISLITWMEVMVGAKKYHQEQRTRIALRSFNIIDVSHDIAERSVDL
RQEYRMTLPDAIILATAQIHRLELITRNTKDFADLPGVVIPYEL
MVKGVALFDTNILIDLFSGRREAQQALEAWPLQNAISLITWMEVMVGAKKYHQEQRTRIALRSFNIIDVSHDIAERSVDL
RQEYRMTLPDAIILATAQIHRLELITRNTKDFADLPGVVIPYEL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|