Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 4343319..4343977 | Replicon | chromosome |
Accession | NZ_CP119076 | ||
Organism | Klebsiella aerogenes strain RX7.1 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | - |
Locus tag | PYR66_RS20665 | Protein ID | WP_275047772.1 |
Coordinates | 4343319..4343636 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | G9Z400 |
Locus tag | PYR66_RS20670 | Protein ID | WP_006818666.1 |
Coordinates | 4343657..4343977 (-) | Length | 107 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYR66_RS20650 (PYR66_20650) | 4339364..4340248 | + | 885 | WP_275047770.1 | DNA adenine methylase | - |
PYR66_RS20655 (PYR66_20655) | 4340753..4342017 | - | 1265 | Protein_4045 | integrase arm-type DNA-binding domain-containing protein | - |
PYR66_RS20660 (PYR66_20660) | 4342536..4343180 | + | 645 | WP_275047771.1 | hypothetical protein | - |
PYR66_RS20665 (PYR66_20665) | 4343319..4343636 | - | 318 | WP_275047772.1 | TA system toxin CbtA family protein | Toxin |
PYR66_RS20670 (PYR66_20670) | 4343657..4343977 | - | 321 | WP_006818666.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
PYR66_RS20675 (PYR66_20675) | 4343996..4344217 | - | 222 | WP_160955864.1 | DUF987 domain-containing protein | - |
PYR66_RS20680 (PYR66_20680) | 4344226..4344708 | - | 483 | WP_275047773.1 | DNA repair protein RadC | - |
PYR66_RS20685 (PYR66_20685) | 4344717..4345175 | - | 459 | WP_275047774.1 | antirestriction protein | - |
PYR66_RS20690 (PYR66_20690) | 4345261..4345497 | - | 237 | WP_008815079.1 | DUF905 domain-containing protein | - |
PYR66_RS20695 (PYR66_20695) | 4345575..4345985 | - | 411 | WP_275047775.1 | hypothetical protein | - |
PYR66_RS20700 (PYR66_20700) | 4346052..4346489 | - | 438 | WP_275047776.1 | hypothetical protein | - |
PYR66_RS20705 (PYR66_20705) | 4346531..4347067 | - | 537 | WP_061068399.1 | DUF4339 domain-containing protein | - |
PYR66_RS20710 (PYR66_20710) | 4347093..4347803 | - | 711 | WP_006818658.1 | DeoR family transcriptional regulator | - |
PYR66_RS20715 (PYR66_20715) | 4348012..4348836 | - | 825 | WP_275047777.1 | DUF932 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4337416..4370830 | 33414 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11952.73 Da Isoelectric Point: 5.6772
>T273739 WP_275047772.1 NZ_CP119076:c4343636-4343319 [Klebsiella aerogenes]
MKNLPATISRAAEPCLSPVAVWQMLLTRLLEQHYGLALNDTPFSDETVIQEHIDAGITLSDAINFLVDKYELVRIDRRGF
SWQEQSPYLRAVDILRARQATGLLR
MKNLPATISRAAEPCLSPVAVWQMLLTRLLEQHYGLALNDTPFSDETVIQEHIDAGITLSDAINFLVDKYELVRIDRRGF
SWQEQSPYLRAVDILRARQATGLLR
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|