Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3725975..3726594 | Replicon | chromosome |
Accession | NZ_CP119076 | ||
Organism | Klebsiella aerogenes strain RX7.1 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A0H3FXE2 |
Locus tag | PYR66_RS17685 | Protein ID | WP_015367918.1 |
Coordinates | 3726376..3726594 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | PYR66_RS17680 | Protein ID | WP_275047287.1 |
Coordinates | 3725975..3726349 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYR66_RS17670 (PYR66_17670) | 3721158..3722357 | + | 1200 | WP_275047285.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PYR66_RS17675 (PYR66_17675) | 3722380..3725526 | + | 3147 | WP_275047286.1 | multidrug efflux RND transporter permease subunit AcrB | - |
PYR66_RS17680 (PYR66_17680) | 3725975..3726349 | + | 375 | WP_275047287.1 | Hha toxicity modulator TomB | Antitoxin |
PYR66_RS17685 (PYR66_17685) | 3726376..3726594 | + | 219 | WP_015367918.1 | HHA domain-containing protein | Toxin |
PYR66_RS17690 (PYR66_17690) | 3726728..3727291 | + | 564 | WP_275047288.1 | maltose O-acetyltransferase | - |
PYR66_RS17695 (PYR66_17695) | 3727417..3727884 | + | 468 | WP_275047289.1 | YlaC family protein | - |
PYR66_RS17700 (PYR66_17700) | 3727862..3729313 | - | 1452 | WP_275050363.1 | PLP-dependent aminotransferase family protein | - |
PYR66_RS17705 (PYR66_17705) | 3729415..3730125 | + | 711 | WP_275047290.1 | GNAT family protein | - |
PYR66_RS17710 (PYR66_17710) | 3730122..3730262 | - | 141 | WP_275047291.1 | type B 50S ribosomal protein L36 | - |
PYR66_RS17715 (PYR66_17715) | 3730265..3730525 | - | 261 | WP_015367923.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8569.96 Da Isoelectric Point: 9.4828
>T273738 WP_015367918.1 NZ_CP119076:3726376-3726594 [Klebsiella aerogenes]
MSGKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSGKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14421.18 Da Isoelectric Point: 4.9045
>AT273738 WP_275047287.1 NZ_CP119076:3725975-3726349 [Klebsiella aerogenes]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNRGWVNDPTSAVNLQINELIEHIATFALNYKIKYAEDNKLISQLDEYL
DDTFMLFSSYGINTSDLQKWRKSGNRLFRCFVSASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNRGWVNDPTSAVNLQINELIEHIATFALNYKIKYAEDNKLISQLDEYL
DDTFMLFSSYGINTSDLQKWRKSGNRLFRCFVSASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|