Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 834831..835488 | Replicon | chromosome |
| Accession | NZ_CP119076 | ||
| Organism | Klebsiella aerogenes strain RX7.1 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | PYR66_RS04060 | Protein ID | WP_275048892.1 |
| Coordinates | 835078..835488 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | PYR66_RS04055 | Protein ID | WP_275048891.1 |
| Coordinates | 834831..835097 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYR66_RS04030 (PYR66_04030) | 829912..831345 | - | 1434 | WP_275048888.1 | 6-phospho-beta-glucosidase BglA | - |
| PYR66_RS04035 (PYR66_04035) | 831465..832193 | - | 729 | WP_275050238.1 | MurR/RpiR family transcriptional regulator | - |
| PYR66_RS04040 (PYR66_04040) | 832244..832555 | + | 312 | WP_275048889.1 | N(4)-acetylcytidine aminohydrolase | - |
| PYR66_RS04045 (PYR66_04045) | 832719..833378 | + | 660 | WP_008806429.1 | hemolysin III family protein | - |
| PYR66_RS04050 (PYR66_04050) | 833613..834596 | - | 984 | WP_275048890.1 | tRNA-modifying protein YgfZ | - |
| PYR66_RS04055 (PYR66_04055) | 834831..835097 | + | 267 | WP_275048891.1 | FAD assembly factor SdhE | Antitoxin |
| PYR66_RS04060 (PYR66_04060) | 835078..835488 | + | 411 | WP_275048892.1 | protein YgfX | Toxin |
| PYR66_RS04065 (PYR66_04065) | 835496..836017 | - | 522 | WP_275048893.1 | flavodoxin FldB | - |
| PYR66_RS04070 (PYR66_04070) | 836118..837014 | + | 897 | WP_275048894.1 | site-specific tyrosine recombinase XerD | - |
| PYR66_RS04075 (PYR66_04075) | 837037..837750 | + | 714 | WP_087859749.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PYR66_RS04080 (PYR66_04080) | 837756..839489 | + | 1734 | WP_275048895.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15866.61 Da Isoelectric Point: 10.4436
>T273732 WP_275048892.1 NZ_CP119076:835078-835488 [Klebsiella aerogenes]
VVLWQSDLRISWRSQWFSLLLHGVVAAIVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHACQGEIKLLIDSRLRWQKT
EWDIVGTPWVISSGMLLRLKQAESGRSQHLWVAADSMDAGEWRDLRRLVQQKPARD
VVLWQSDLRISWRSQWFSLLLHGVVAAIVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHACQGEIKLLIDSRLRWQKT
EWDIVGTPWVISSGMLLRLKQAESGRSQHLWVAADSMDAGEWRDLRRLVQQKPARD
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|