Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 2019852..2020322 Replicon chromosome
Accession NZ_CP119047
Organism Staphylococcus epidermidis strain N2

Toxin (Protein)


Gene name TsaT Uniprot ID Q5HQS5
Locus tag PZB81_RS09705 Protein ID WP_001829569.1
Coordinates 2020134..2020322 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID -
Locus tag PZB81_RS09700 Protein ID WP_074839211.1
Coordinates 2019852..2020109 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PZB81_RS09665 (PZB81_09665) 2015117..2015659 - 543 WP_002476477.1 nitroreductase -
PZB81_RS09670 (PZB81_09670) 2015740..2016456 - 717 WP_002493469.1 type I 3-dehydroquinate dehydratase -
PZB81_RS09675 (PZB81_09675) 2016617..2017039 + 423 WP_002457221.1 organic hydroperoxide resistance protein -
PZB81_RS09680 (PZB81_09680) 2017445..2017945 + 501 WP_002474267.1 GNAT family N-acetyltransferase -
PZB81_RS09685 (PZB81_09685) 2018215..2018802 - 588 WP_002493470.1 histidine phosphatase family protein -
PZB81_RS09690 (PZB81_09690) 2019015..2019251 + 237 WP_002457224.1 hypothetical protein -
PZB81_RS09695 (PZB81_09695) 2019243..2019446 - 204 WP_002438966.1 sterile alpha motif-like domain-containing protein -
PZB81_RS09700 (PZB81_09700) 2019852..2020109 + 258 WP_074839211.1 hypothetical protein Antitoxin
PZB81_RS09705 (PZB81_09705) 2020134..2020322 + 189 WP_001829569.1 hypothetical protein Toxin
PZB81_RS09710 (PZB81_09710) 2020512..2021066 + 555 WP_002493471.1 lipoprotein N-acylation protein LnsA -
PZB81_RS09715 (PZB81_09715) 2021126..2021359 - 234 WP_001829664.1 hypothetical protein -
PZB81_RS09720 (PZB81_09720) 2021644..2022390 + 747 WP_002493472.1 poly-gamma-glutamate hydrolase family protein -
PZB81_RS09725 (PZB81_09725) 2022488..2022772 + 285 WP_002493473.1 hypothetical protein -
PZB81_RS09730 (PZB81_09730) 2022797..2023021 + 225 WP_002493474.1 hypothetical protein -
PZB81_RS09735 (PZB81_09735) 2023643..2023843 - 201 WP_002493475.1 cold-shock protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7229.94 Da        Isoelectric Point: 9.7844

>T273730 WP_001829569.1 NZ_CP119047:2020134-2020322 [Staphylococcus epidermidis]
MSLHFQILLWLSILFIIAGTILLVTMLKTKKEERKESYLGFTVIFLIFGFAILIYTFIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 10044.08 Da        Isoelectric Point: 4.5440

>AT273730 WP_074839211.1 NZ_CP119047:2019852-2020109 [Staphylococcus epidermidis]
MKLNKTNIFNLIFTILFFSFNILITYNANIDYKLWLIPGLAICGFALFSSLTLVIIYSDLFSEILFFINIILALYYIYPI
FYEFV

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0N0LUH8

Antitoxin

Source ID Structure

References