Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /HTH_XRE(antitoxin) |
Location | 1887851..1888653 | Replicon | chromosome |
Accession | NZ_CP119047 | ||
Organism | Staphylococcus epidermidis strain N2 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | PZB81_RS09030 | Protein ID | WP_002493409.1 |
Coordinates | 1888192..1888653 (+) | Length | 154 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | PZB81_RS09025 | Protein ID | WP_002493408.1 |
Coordinates | 1887851..1888180 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PZB81_RS08990 (PZB81_08990) | 1883742..1885694 | - | 1953 | WP_002493404.1 | AAA family ATPase | - |
PZB81_RS08995 (PZB81_08995) | 1885763..1885939 | - | 177 | WP_002493405.1 | hypothetical protein | - |
PZB81_RS09000 (PZB81_09000) | 1886005..1886214 | - | 210 | WP_001830281.1 | hypothetical protein | - |
PZB81_RS09005 (PZB81_09005) | 1886227..1886946 | - | 720 | WP_002493406.1 | phage repressor protein | - |
PZB81_RS09010 (PZB81_09010) | 1886996..1887235 | + | 240 | WP_002475580.1 | hypothetical protein | - |
PZB81_RS09015 (PZB81_09015) | 1887225..1887404 | - | 180 | WP_002475588.1 | hypothetical protein | - |
PZB81_RS09020 (PZB81_09020) | 1887418..1887657 | - | 240 | WP_002493407.1 | helix-turn-helix transcriptional regulator | - |
PZB81_RS09025 (PZB81_09025) | 1887851..1888180 | + | 330 | WP_002493408.1 | helix-turn-helix transcriptional regulator | Antitoxin |
PZB81_RS09030 (PZB81_09030) | 1888192..1888653 | + | 462 | WP_002493409.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
PZB81_RS09035 (PZB81_09035) | 1888883..1889191 | + | 309 | WP_002493410.1 | hypothetical protein | - |
PZB81_RS09040 (PZB81_09040) | 1889193..1889774 | + | 582 | WP_002493411.1 | hypothetical protein | - |
PZB81_RS09045 (PZB81_09045) | 1889837..1890886 | + | 1050 | WP_002493412.1 | site-specific integrase | - |
PZB81_RS09060 (PZB81_09060) | 1891288..1891863 | - | 576 | WP_002493413.1 | competence protein ComK | - |
PZB81_RS09065 (PZB81_09065) | 1892078..1892296 | + | 219 | WP_001829292.1 | IDEAL domain-containing protein | - |
PZB81_RS09070 (PZB81_09070) | 1892374..1893360 | - | 987 | WP_002493414.1 | lipoate--protein ligase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1845104..1890886 | 45782 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 18183.68 Da Isoelectric Point: 5.9380
>T273729 WP_002493409.1 NZ_CP119047:1888192-1888653 [Staphylococcus epidermidis]
MGLYEEICIDNDMVEIKETNKLPSFQSGFYMNGTVYIKSDLSEKEKIKVLYEELAHHKLTYGNILDQSKFNNRKFENYAR
RHGYEAALPLRIIVEAHNYGVSNLYELAEYVQLSEEYIAEILKHYKNKYGIGTHYEEYLITFDPLRVFKYKEI
MGLYEEICIDNDMVEIKETNKLPSFQSGFYMNGTVYIKSDLSEKEKIKVLYEELAHHKLTYGNILDQSKFNNRKFENYAR
RHGYEAALPLRIIVEAHNYGVSNLYELAEYVQLSEEYIAEILKHYKNKYGIGTHYEEYLITFDPLRVFKYKEI
Download Length: 462 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|