Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 985140..985945 | Replicon | chromosome |
Accession | NZ_CP119047 | ||
Organism | Staphylococcus epidermidis strain N2 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | - |
Locus tag | PZB81_RS04810 | Protein ID | WP_002493979.1 |
Coordinates | 985763..985945 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | - |
Locus tag | PZB81_RS04805 | Protein ID | WP_002493980.1 |
Coordinates | 985140..985739 (+) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PZB81_RS04780 (PZB81_04780) | 980349..981806 | + | 1458 | WP_002493984.1 | ABC transporter substrate-binding protein/permease | - |
PZB81_RS04785 (PZB81_04785) | 981799..982521 | + | 723 | WP_002493983.1 | amino acid ABC transporter ATP-binding protein | - |
PZB81_RS04790 (PZB81_04790) | 983017..983172 | + | 156 | WP_002493982.1 | hypothetical protein | - |
PZB81_RS04795 (PZB81_04795) | 983385..984515 | + | 1131 | WP_001829814.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
PZB81_RS04800 (PZB81_04800) | 984512..984982 | + | 471 | WP_002493981.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
PZB81_RS04805 (PZB81_04805) | 985140..985739 | + | 600 | WP_002493980.1 | hypothetical protein | Antitoxin |
PZB81_RS04810 (PZB81_04810) | 985763..985945 | + | 183 | WP_002493979.1 | SAS053 family protein | Toxin |
PZB81_RS04815 (PZB81_04815) | 986097..986501 | + | 405 | WP_002493978.1 | hypothetical protein | - |
PZB81_RS04820 (PZB81_04820) | 986687..988072 | + | 1386 | WP_002493977.1 | class II fumarate hydratase | - |
PZB81_RS04825 (PZB81_04825) | 988433..989257 | - | 825 | WP_002493976.1 | RluA family pseudouridine synthase | - |
PZB81_RS04830 (PZB81_04830) | 989416..990549 | + | 1134 | WP_002493975.1 | GAF domain-containing sensor histidine kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 983017..983172 | 155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 7070.63 Da Isoelectric Point: 4.3016
>T273728 WP_002493979.1 NZ_CP119047:985763-985945 [Staphylococcus epidermidis]
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQSHDNEVRSDFKNSK
MANKKDSKLNYHEEENAMVTDLDDLKELGKEMEQISQENDEEKLNQSHDNEVRSDFKNSK
Download Length: 183 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22670.59 Da Isoelectric Point: 4.8668
>AT273728 WP_002493980.1 NZ_CP119047:985140-985739 [Staphylococcus epidermidis]
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLSKEQAPVFDELKKNVENHAVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENDAIDFISDKIKTKENKGKLTMQVLTIDENGKLDISVRQGLMEAREIFLVITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
MAMNFKVFDNSEKVAEYTADILRKQFNNNPTTIAGFHLSKEQAPVFDELKKNVENHAVDFSQINILDYDDNHSYYEALGV
PTGQIYSISYENDAIDFISDKIKTKENKGKLTMQVLTIDENGKLDISVRQGLMEAREIFLVITGANKRDMVEKLYRENGK
TSFEPSDLKAHRMVNVILDKEAAAGLPEDVKEYFTARFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|