Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 822537..823066 | Replicon | chromosome |
Accession | NZ_CP119047 | ||
Organism | Staphylococcus epidermidis strain N2 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q5HME7 |
Locus tag | PZB81_RS03845 | Protein ID | WP_001829891.1 |
Coordinates | 822704..823066 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | Q5HME6 |
Locus tag | PZB81_RS03840 | Protein ID | WP_001829931.1 |
Coordinates | 822537..822707 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PZB81_RS03815 (PZB81_03815) | 818340..818819 | + | 480 | WP_002494210.1 | PH domain-containing protein | - |
PZB81_RS03820 (PZB81_03820) | 818812..820338 | + | 1527 | WP_275113494.1 | PH domain-containing protein | - |
PZB81_RS03825 (PZB81_03825) | 820325..820834 | + | 510 | WP_002494208.1 | PH domain-containing protein | - |
PZB81_RS03830 (PZB81_03830) | 820882..821235 | + | 354 | WP_001829915.1 | holo-ACP synthase | - |
PZB81_RS03835 (PZB81_03835) | 821302..822450 | + | 1149 | WP_002494207.1 | alanine racemase | - |
PZB81_RS03840 (PZB81_03840) | 822537..822707 | + | 171 | WP_001829931.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
PZB81_RS03845 (PZB81_03845) | 822704..823066 | + | 363 | WP_001829891.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PZB81_RS03850 (PZB81_03850) | 823411..824412 | + | 1002 | WP_002494206.1 | PP2C family protein-serine/threonine phosphatase | - |
PZB81_RS03855 (PZB81_03855) | 824512..824838 | + | 327 | WP_001829952.1 | anti-sigma factor antagonist | - |
PZB81_RS03860 (PZB81_03860) | 824840..825319 | + | 480 | WP_002474646.1 | anti-sigma B factor RsbW | - |
PZB81_RS03865 (PZB81_03865) | 825294..826064 | + | 771 | WP_002474636.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13497.65 Da Isoelectric Point: 9.9522
>T273727 WP_001829891.1 NZ_CP119047:822704-823066 [Staphylococcus epidermidis]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2G7HWR0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0N1EF65 |