Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
Location | 2093..2673 | Replicon | plasmid unnamed1 |
Accession | NZ_CP119015 | ||
Organism | Klebsiella pneumoniae strain CR-hvKP005 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A8J3DTL7 |
Locus tag | PY729_RS27665 | Protein ID | WP_071177730.1 |
Coordinates | 2093..2407 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2X1PRM1 |
Locus tag | PY729_RS27670 | Protein ID | WP_000093040.1 |
Coordinates | 2395..2673 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PY729_RS27645 (PY729_27645) | 1..732 | + | 732 | WP_071177728.1 | MobC family replication-relaxation protein | - |
PY729_RS27650 (PY729_27650) | 739..1269 | + | 531 | WP_071177729.1 | hypothetical protein | - |
PY729_RS27655 (PY729_27655) | 1296..1475 | - | 180 | WP_000165970.1 | Rop family plasmid primer RNA-binding protein | - |
PY729_RS27660 (PY729_27660) | 1501..1929 | - | 429 | WP_001140599.1 | hypothetical protein | - |
PY729_RS27665 (PY729_27665) | 2093..2407 | - | 315 | WP_071177730.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PY729_RS27670 (PY729_27670) | 2395..2673 | - | 279 | WP_000093040.1 | CopG family ribbon-helix-helix protein | Antitoxin |
PY729_RS27675 (PY729_27675) | 2848..3213 | - | 366 | WP_072354022.1 | TonB family protein | - |
PY729_RS27680 (PY729_27680) | 3210..3581 | - | 372 | WP_001237044.1 | cell envelope integrity protein TolA | - |
PY729_RS27685 (PY729_27685) | 3855..4100 | - | 246 | WP_032440458.1 | hypothetical protein | - |
PY729_RS27690 (PY729_27690) | 4745..6232 | + | 1488 | WP_004178082.1 | group II intron reverse transcriptase/maturase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..11970 | 11970 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11805.73 Da Isoelectric Point: 9.8324
>T273724 WP_071177730.1 NZ_CP119015:c2407-2093 [Klebsiella pneumoniae]
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|