Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4221564..4222183 Replicon chromosome
Accession NZ_CP119013
Organism Klebsiella pneumoniae strain CR-hvKP005

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag PY729_RS21060 Protein ID WP_002892050.1
Coordinates 4221965..4222183 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag PY729_RS21055 Protein ID WP_002892066.1
Coordinates 4221564..4221938 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PY729_RS21045 (PY729_21045) 4216716..4217909 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
PY729_RS21050 (PY729_21050) 4217932..4221078 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
PY729_RS21055 (PY729_21055) 4221564..4221938 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
PY729_RS21060 (PY729_21060) 4221965..4222183 + 219 WP_002892050.1 HHA domain-containing protein Toxin
PY729_RS21065 (PY729_21065) 4222342..4222908 + 567 WP_002892030.1 maltose O-acetyltransferase -
PY729_RS21070 (PY729_21070) 4222880..4223020 - 141 WP_004147370.1 hypothetical protein -
PY729_RS21075 (PY729_21075) 4223041..4223511 + 471 WP_002892026.1 YlaC family protein -
PY729_RS21080 (PY729_21080) 4223486..4224937 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
PY729_RS21085 (PY729_21085) 4225038..4225736 + 699 WP_002892021.1 GNAT family protein -
PY729_RS21090 (PY729_21090) 4225733..4225873 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
PY729_RS21095 (PY729_21095) 4225873..4226136 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T273715 WP_002892050.1 NZ_CP119013:4221965-4222183 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT273715 WP_002892066.1 NZ_CP119013:4221564-4221938 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References