Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yoeB-relB/YoeB-YefM
Location 2322005..2322507 Replicon chromosome
Accession NZ_CP118993
Organism Aeromonas media strain K521

Toxin (Protein)


Gene name yoeB Uniprot ID Q5XQD8
Locus tag PYU99_RS10710 Protein ID WP_032492620.1
Coordinates 2322253..2322507 (+) Length 85 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A1V0BEH6
Locus tag PYU99_RS10705 Protein ID WP_032492621.1
Coordinates 2322005..2322256 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PYU99_RS10685 (PYU99_10685) 2317906..2319447 - 1542 WP_000050481.1 IS91-like element ISCR1 family transposase -
PYU99_RS10690 (PYU99_10690) 2319852..2320691 - 840 WP_000259031.1 sulfonamide-resistant dihydropteroate synthase Sul1 -
PYU99_RS10695 (PYU99_10695) 2320685..2321032 - 348 WP_000679427.1 quaternary ammonium compound efflux SMR transporter QacE delta 1 -
PYU99_RS10700 (PYU99_10700) 2321189..2321821 - 633 WP_000186237.1 type B-3 chloramphenicol O-acetyltransferase CatB3 -
PYU99_RS10705 (PYU99_10705) 2322005..2322256 + 252 WP_032492621.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
PYU99_RS10710 (PYU99_10710) 2322253..2322507 + 255 WP_032492620.1 Txe/YoeB family addiction module toxin Toxin
PYU99_RS10715 (PYU99_10715) 2322580..2323134 - 555 WP_012695458.1 AAC(6')-Ib family aminoglycoside 6'-N-acetyltransferase -
PYU99_RS10720 (PYU99_10720) 2323183..2323971 - 789 Protein_2049 AadA family aminoglycoside 3''-O-nucleotidyltransferase -
PYU99_RS10725 (PYU99_10725) 2324218..2325231 + 1014 WP_000845048.1 class 1 integron integrase IntI1 -
PYU99_RS10730 (PYU99_10730) 2325568..2326128 + 561 WP_001161490.1 recombinase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island catB3 / aadA2 / sul1 / mph(A) / blaPER-3 / ant(3'')-Ii-aac(6')-IId adeG / adeG 2251416..2337736 86320
- inside IScluster/Tn mph(A) / sul1 / blaPER-3 / catB3 / ant(3'')-Ii-aac(6')-IId - 2303830..2329098 25268
- inside Integron catB3 - 2321135..2325231 4096


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(5-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 10272.81 Da        Isoelectric Point: 9.3585

>T273704 WP_032492620.1 NZ_CP118993:2322253-2322507 [Aeromonas media]
MRLIFSDDAWEDYLFWQKQDRRMVDRINKLIKETTREPFSGVGKPEPLKHALAGYWSRRITDEHRMVYKVADDALWIVQL
KYHY

Download         Length: 255 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9244.40 Da        Isoelectric Point: 4.7769

>AT273704 WP_032492621.1 NZ_CP118993:2322005-2322256 [Aeromonas media]
MDAITYTHARANLAGTMDRVCNDHEPVIITRNGDQSVVILSLEDFQALEETAYLLRSPANAKRLFKSIEQLEAGRGQARE
LAE

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1V0BEH9

Antitoxin

Source ID Structure
AlphaFold DB A0A1V0BEH6

References