Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 23712..24259 | Replicon | plasmid pK520-TEM |
Accession | NZ_CP118992 | ||
Organism | Aeromonas allosaccharophila strain K520 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | PYU98_RS25650 | Protein ID | WP_134997959.1 |
Coordinates | 23951..24259 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | - |
Locus tag | PYU98_RS25645 | Protein ID | WP_134997958.1 |
Coordinates | 23712..23951 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYU98_RS25625 (PYU98_25625) | 20720..21157 | - | 438 | WP_244776905.1 | hypothetical protein | - |
PYU98_RS25630 (PYU98_25630) | 21241..21888 | - | 648 | WP_270796700.1 | DUF2914 domain-containing protein | - |
PYU98_RS25635 (PYU98_25635) | 22793..23242 | + | 450 | WP_275058455.1 | tetratricopeptide repeat protein | - |
PYU98_RS25640 (PYU98_25640) | 23386..23655 | + | 270 | WP_270796694.1 | hypothetical protein | - |
PYU98_RS25645 (PYU98_25645) | 23712..23951 | + | 240 | WP_134997958.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
PYU98_RS25650 (PYU98_25650) | 23951..24259 | + | 309 | WP_134997959.1 | CcdB family protein | Toxin |
PYU98_RS25655 (PYU98_25655) | 24407..24901 | + | 495 | Protein_27 | replication initiation protein | - |
PYU98_RS25660 (PYU98_25660) | 25043..25552 | + | 510 | Protein_28 | TetR/AcrR family transcriptional regulator | - |
PYU98_RS25665 (PYU98_25665) | 25564..26157 | + | 594 | Protein_29 | Tn3 family transposase | - |
PYU98_RS25670 (PYU98_25670) | 26195..26362 | + | 168 | WP_275058456.1 | hypothetical protein | - |
PYU98_RS25675 (PYU98_25675) | 26492..27133 | + | 642 | WP_033147139.1 | AAA family ATPase | - |
PYU98_RS25680 (PYU98_25680) | 27172..27456 | + | 285 | WP_033147140.1 | hypothetical protein | - |
PYU98_RS25685 (PYU98_25685) | 27679..28143 | + | 465 | Protein_33 | replication protein RepA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaTEM-1C | - | 1..73881 | 73881 | |
- | flank | IS/Tn | - | - | 25582..26157 | 575 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11431.30 Da Isoelectric Point: 4.6920
>T273702 WP_134997959.1 NZ_CP118992:23951-24259 [Aeromonas allosaccharophila]
MQFTIYRNKGNARAYPYLLDVQSDIIGELATRMVIPLFPLVAFTGRPAQRLNPVIIVEGDKYLVMTQDMAAVRLAQLGDE
VTGVQESRQLIKDAIDFLFDGV
MQFTIYRNKGNARAYPYLLDVQSDIIGELATRMVIPLFPLVAFTGRPAQRLNPVIIVEGDKYLVMTQDMAAVRLAQLGDE
VTGVQESRQLIKDAIDFLFDGV
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|