Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 178517..179036 | Replicon | plasmid pK520-MPH |
Accession | NZ_CP118990 | ||
Organism | Aeromonas allosaccharophila strain K520 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A2L0U0N7 |
Locus tag | PYU98_RS25305 | Protein ID | WP_068979439.1 |
Coordinates | 178517..178804 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2L0U081 |
Locus tag | PYU98_RS25310 | Protein ID | WP_068979438.1 |
Coordinates | 178794..179036 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYU98_RS25290 (PYU98_25290) | 173689..174291 | + | 603 | WP_010465829.1 | recombinase family protein | - |
PYU98_RS25295 (PYU98_25295) | 174275..177304 | + | 3030 | WP_032432545.1 | Tn3 family transposase | - |
PYU98_RS25300 (PYU98_25300) | 177336..178334 | - | 999 | WP_275058415.1 | replication initiation protein | - |
PYU98_RS25305 (PYU98_25305) | 178517..178804 | - | 288 | WP_068979439.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PYU98_RS25310 (PYU98_25310) | 178794..179036 | - | 243 | WP_068979438.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PYU98_RS25315 (PYU98_25315) | 179215..179844 | + | 630 | WP_068979437.1 | ParA family partition ATPase | - |
PYU98_RS25320 (PYU98_25320) | 179841..180074 | + | 234 | WP_068979436.1 | hypothetical protein | - |
PYU98_RS25325 (PYU98_25325) | 180142..181410 | - | 1269 | WP_011191342.1 | IS4-like element ISApu1 family transposase | - |
PYU98_RS25330 (PYU98_25330) | 181728..182099 | - | 372 | WP_004099020.1 | hypothetical protein | - |
PYU98_RS25335 (PYU98_25335) | 182256..183530 | + | 1275 | WP_045892401.1 | IS4-like element ISApu2 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | - | - | 173566..191498 | 17932 | |
- | inside | Non-Mobilizable plasmid | msr(E) / mph(E) | galU | 1..208934 | 208934 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11370.15 Da Isoelectric Point: 9.7908
>T273701 WP_068979439.1 NZ_CP118990:c178804-178517 [Aeromonas allosaccharophila]
MTFELEFDPRAWKEWKKLGDTVRQQFKKKLSEVIERPRIEANRLNGMSDCYKIKLRGAGYRLVYQVQDDRVVVFVVAVGR
REREEVYLDAMSRLD
MTFELEFDPRAWKEWKKLGDTVRQQFKKKLSEVIERPRIEANRLNGMSDCYKIKLRGAGYRLVYQVQDDRVVVFVVAVGR
REREEVYLDAMSRLD
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2L0U0N7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2L0U081 |