Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
| Location | 172804..173497 | Replicon | plasmid pK520-MPH |
| Accession | NZ_CP118990 | ||
| Organism | Aeromonas allosaccharophila strain K520 | ||
Toxin (Protein)
| Gene name | tad | Uniprot ID | - |
| Locus tag | PYU98_RS25285 | Protein ID | WP_000182276.1 |
| Coordinates | 173141..173497 (-) | Length | 119 a.a. |
Antitoxin (Protein)
| Gene name | ata | Uniprot ID | N2IIN5 |
| Locus tag | PYU98_RS25280 | Protein ID | WP_001172026.1 |
| Coordinates | 172804..173139 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYU98_RS25240 (PYU98_25240) | 168663..169274 | - | 612 | WP_015060246.1 | recombinase family protein | - |
| PYU98_RS25245 (PYU98_25245) | 169483..170013 | - | 531 | WP_000172759.1 | hypothetical protein | - |
| PYU98_RS25250 (PYU98_25250) | 170357..171049 | - | 693 | WP_230679382.1 | HD-GYP domain-containing protein | - |
| PYU98_RS25255 (PYU98_25255) | 171245..171349 | - | 105 | Protein_177 | hypothetical protein | - |
| PYU98_RS25260 (PYU98_25260) | 171310..171570 | - | 261 | WP_239991406.1 | DUF3391 domain-containing protein | - |
| PYU98_RS25265 (PYU98_25265) | 171727..172107 | - | 381 | WP_001054412.1 | hypothetical protein | - |
| PYU98_RS25270 (PYU98_25270) | 172104..172430 | - | 327 | WP_000091614.1 | hypothetical protein | - |
| PYU98_RS25275 (PYU98_25275) | 172454..172789 | - | 336 | WP_000741275.1 | hypothetical protein | - |
| PYU98_RS25280 (PYU98_25280) | 172804..173139 | - | 336 | WP_001172026.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| PYU98_RS25285 (PYU98_25285) | 173141..173497 | - | 357 | WP_000182276.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PYU98_RS25290 (PYU98_25290) | 173689..174291 | + | 603 | WP_010465829.1 | recombinase family protein | - |
| PYU98_RS25295 (PYU98_25295) | 174275..177304 | + | 3030 | WP_032432545.1 | Tn3 family transposase | - |
| PYU98_RS25300 (PYU98_25300) | 177336..178334 | - | 999 | WP_275058415.1 | replication initiation protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | msr(E) / mph(E) | galU | 1..208934 | 208934 | |
| - | inside | IScluster/Tn | - | - | 173566..191498 | 17932 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 12912.93 Da Isoelectric Point: 8.9018
>T273700 WP_000182276.1 NZ_CP118990:c173497-173141 [Aeromonas allosaccharophila]
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKELKGFGGAGVLKVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQEL
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKELKGFGGAGVLKVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQEL
Download Length: 357 bp
Antitoxin
Download Length: 112 a.a. Molecular weight: 12201.39 Da Isoelectric Point: 10.6058
>AT273700 WP_001172026.1 NZ_CP118990:c173139-172804 [Aeromonas allosaccharophila]
MQKRIIEGVEVQRSSGNVFADLGLPDAEKLKIKTGLVVEIRRAMRALGLTQQAAAKRMGIPQPKVSGMMRGDFTNLSERK
LMDCLNRLGYDIEIKVRPAAEPIGHLTLATA
MQKRIIEGVEVQRSSGNVFADLGLPDAEKLKIKTGLVVEIRRAMRALGLTQQAAAKRMGIPQPKVSGMMRGDFTNLSERK
LMDCLNRLGYDIEIKVRPAAEPIGHLTLATA
Download Length: 336 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|