Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
Location | 4292..4860 | Replicon | plasmid pK520-KPC |
Accession | NZ_CP118989 | ||
Organism | Aeromonas allosaccharophila strain K520 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | PYU98_RS23210 | Protein ID | WP_101617266.1 |
Coordinates | 4292..4585 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | PYU98_RS23215 | Protein ID | WP_101617265.1 |
Coordinates | 4573..4860 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYU98_RS23190 (PYU98_23190) | 1..870 | + | 870 | WP_148248203.1 | replication protein RepA | - |
PYU98_RS23195 (PYU98_23195) | 1873..2409 | - | 537 | WP_107979027.1 | tetratricopeptide repeat protein | - |
PYU98_RS23200 (PYU98_23200) | 2468..2872 | - | 405 | WP_010674034.1 | IS200/IS605-like element ISAs26 family transposase | - |
PYU98_RS23205 (PYU98_23205) | 2930..4156 | + | 1227 | WP_021141234.1 | RNA-guided endonuclease TnpB family protein | - |
PYU98_RS23210 (PYU98_23210) | 4292..4585 | - | 294 | WP_101617266.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PYU98_RS23215 (PYU98_23215) | 4573..4860 | - | 288 | WP_101617265.1 | CopG family ribbon-helix-helix protein | Antitoxin |
PYU98_RS23220 (PYU98_23220) | 4884..5402 | + | 519 | WP_275058391.1 | hypothetical protein | - |
PYU98_RS23225 (PYU98_23225) | 5684..6442 | - | 759 | WP_101617261.1 | hypothetical protein | - |
PYU98_RS23230 (PYU98_23230) | 7150..9747 | - | 2598 | WP_101617259.1 | AAA family ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | mph(A) / aac(3)-IId / aph(6)-Id / aph(3'')-Ib / blaKPC-2 / aph(3')-VIb | katB | 1..243463 | 243463 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10980.79 Da Isoelectric Point: 10.6871
>T273699 WP_101617266.1 NZ_CP118989:c4585-4292 [Aeromonas allosaccharophila]
MPPVIFAPAALRDLQRLREFLRPKSPQVAQRAATTIQLSLRQLAAQPSMGRPIEGLPEAFREWVIPFGDSGYLARYRIEP
DVIVVLAVRHQREVGYS
MPPVIFAPAALRDLQRLREFLRPKSPQVAQRAATTIQLSLRQLAAQPSMGRPIEGLPEAFREWVIPFGDSGYLARYRIEP
DVIVVLAVRHQREVGYS
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|