Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 920673..921202 | Replicon | chromosome |
| Accession | NZ_CP118982 | ||
| Organism | Staphylococcus equorum strain DSM 20674 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | K7S376 |
| Locus tag | PYW44_RS04350 | Protein ID | WP_002511418.1 |
| Coordinates | 920840..921202 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | J9GY23 |
| Locus tag | PYW44_RS04345 | Protein ID | WP_002507108.1 |
| Coordinates | 920673..920843 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYW44_RS04320 | 916424..916903 | + | 480 | WP_021339947.1 | PH domain-containing protein | - |
| PYW44_RS04325 | 916896..918401 | + | 1506 | WP_021339948.1 | PH domain-containing protein | - |
| PYW44_RS04330 | 918394..918930 | + | 537 | WP_002507105.1 | PH domain-containing protein | - |
| PYW44_RS04335 | 918963..919313 | + | 351 | WP_021339949.1 | holo-ACP synthase | - |
| PYW44_RS04340 | 919437..920585 | + | 1149 | WP_021339950.1 | alanine racemase | - |
| PYW44_RS04345 | 920673..920843 | + | 171 | WP_002507108.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| PYW44_RS04350 | 920840..921202 | + | 363 | WP_002511418.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PYW44_RS04355 | 921561..922562 | + | 1002 | WP_002507111.1 | PP2C family protein-serine/threonine phosphatase | - |
| PYW44_RS04360 | 922642..922968 | + | 327 | WP_002511417.1 | anti-sigma factor antagonist | - |
| PYW44_RS04365 | 922970..923452 | + | 483 | WP_002507113.1 | anti-sigma B factor RsbW | - |
| PYW44_RS04370 | 923427..924197 | + | 771 | WP_002507114.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13432.59 Da Isoelectric Point: 10.2178
>T273692 WP_002511418.1 NZ_CP118982:920840-921202 [Staphylococcus equorum]
MMRRGDVYLADLSPVQGSEQGGIRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKSKYKLDKDSVILLEQIR
TLDKNRLKEKLTYLSESKMKEVNVAIDISLGLHNVRNSKS
MMRRGDVYLADLSPVQGSEQGGIRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKSKYKLDKDSVILLEQIR
TLDKNRLKEKLTYLSESKMKEVNVAIDISLGLHNVRNSKS
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|