Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 2004129..2004597 Replicon chromosome
Accession NZ_CP118979
Organism Staphylococcus haemolyticus strain DSM 20263

Toxin (Protein)


Gene name TsaT Uniprot ID Q4L4Q4
Locus tag PYW40_RS09740 Protein ID WP_011276326.1
Coordinates 2004409..2004597 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID Q4L4Q5
Locus tag PYW40_RS09735 Protein ID WP_011276325.1
Coordinates 2004129..2004386 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PYW40_RS09700 1999305..2000030 - 726 WP_037558439.1 type I 3-dehydroquinate dehydratase -
PYW40_RS09705 2000193..2000615 + 423 WP_016931015.1 organic hydroperoxide resistance protein -
PYW40_RS09710 2000878..2001369 + 492 WP_011276321.1 GNAT family N-acetyltransferase -
PYW40_RS09715 2001501..2002118 + 618 WP_011276322.1 LysE/ArgO family amino acid transporter -
PYW40_RS09720 2002305..2002913 - 609 WP_011276323.1 histidine phosphatase family protein -
PYW40_RS09725 2003141..2003383 + 243 WP_011276324.1 hypothetical protein -
PYW40_RS09730 2003375..2003578 - 204 WP_033079647.1 sterile alpha motif-like domain-containing protein -
PYW40_RS09735 2004129..2004386 + 258 WP_011276325.1 hypothetical protein Antitoxin
PYW40_RS09740 2004409..2004597 + 189 WP_011276326.1 hypothetical protein Toxin
PYW40_RS09745 2004715..2005296 + 582 WP_011276327.1 lipoprotein N-acylation protein LnsA -
PYW40_RS09750 2005344..2005580 - 237 WP_016931008.1 hypothetical protein -
PYW40_RS09755 2005750..2006496 + 747 WP_037558435.1 membrane lipoprotein lipid attachment site-containing protein -
PYW40_RS09760 2006565..2007173 - 609 WP_011276331.1 GNAT family N-acetyltransferase -
PYW40_RS09765 2007310..2008056 + 747 WP_011276332.1 poly-gamma-glutamate hydrolase family protein -
PYW40_RS09770 2008132..2008419 + 288 WP_011276333.1 hypothetical protein -
PYW40_RS09775 2008665..2008889 + 225 WP_011276334.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside SCCmec - clpP 1817285..2207448 390163


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7110.80 Da        Isoelectric Point: 9.6269

>T273688 WP_011276326.1 NZ_CP118979:2004409-2004597 [Staphylococcus haemolyticus]
MSLHLTILLWLGIIFVIAASIILGLLLKSKKEERKESYLGFTVIFYIFGFALLIYVFIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9914.97 Da        Isoelectric Point: 4.0625

>AT273688 WP_011276325.1 NZ_CP118979:2004129-2004386 [Staphylococcus haemolyticus]
MNNNKIFWINIFMTLLFLGFNIIVTYNADLDDFFWLIPGLTISGITIVLSLSTALICKNLVSEVIFLINIVMLLYYIYPM
VYTFF

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2A1KAB5

Antitoxin

Source ID Structure
AlphaFold DB A0A2A1KAX9

References