Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tsbAT/- |
| Location | 1036238..1037009 | Replicon | chromosome |
| Accession | NZ_CP118979 | ||
| Organism | Staphylococcus haemolyticus strain DSM 20263 | ||
Toxin (Protein)
| Gene name | tsbT | Uniprot ID | - |
| Locus tag | PYW40_RS05120 | Protein ID | WP_011275410.1 |
| Coordinates | 1036860..1037009 (+) | Length | 50 a.a. |
Antitoxin (Protein)
| Gene name | tsbA | Uniprot ID | Q4L7F8 |
| Locus tag | PYW40_RS05115 | Protein ID | WP_011275409.1 |
| Coordinates | 1036238..1036837 (+) | Length | 200 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYW40_RS05095 | 1032121..1033575 | + | 1455 | WP_053019944.1 | ABC transporter substrate-binding protein/permease | - |
| PYW40_RS05100 | 1033568..1034290 | + | 723 | WP_016931345.1 | amino acid ABC transporter ATP-binding protein | - |
| PYW40_RS05105 | 1034468..1035595 | + | 1128 | WP_011275407.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
| PYW40_RS05110 | 1035596..1036066 | + | 471 | WP_016931343.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
| PYW40_RS05115 | 1036238..1036837 | + | 600 | WP_011275409.1 | glucosamine-6-phosphate isomerase | Antitoxin |
| PYW40_RS05120 | 1036860..1037009 | + | 150 | WP_011275410.1 | SAS053 family protein | Toxin |
| PYW40_RS05125 | 1037220..1037615 | + | 396 | WP_057504773.1 | hypothetical protein | - |
| PYW40_RS05130 | 1037822..1039207 | + | 1386 | WP_011275412.1 | class II fumarate hydratase | - |
| PYW40_RS05135 | 1039273..1040097 | - | 825 | WP_011275413.1 | RluA family pseudouridine synthase | - |
| PYW40_RS05140 | 1040285..1041394 | + | 1110 | WP_011275414.1 | GAF domain-containing sensor histidine kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5796.18 Da Isoelectric Point: 3.9484
>T273687 WP_011275410.1 NZ_CP118979:1036860-1037009 [Staphylococcus haemolyticus]
MTKNKDSELNYHEEENAMVQDLDDLKTLGKEMEQISEENDEDKLNQSHE
MTKNKDSELNYHEEENAMVQDLDDLKTLGKEMEQISEENDEDKLNQSHE
Download Length: 150 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22272.12 Da Isoelectric Point: 4.7588
>AT273687 WP_011275409.1 NZ_CP118979:1036238-1036837 [Staphylococcus haemolyticus]
MAMNFKVFNDVEHVAEYTADIIRKQFNNNPTTIAGIHLTKDAAPVLDELKKDVDHNAVDFSQVNILDYDDNRSYYEALGV
PASQIYPINLDDDAESLIDDKIKTKENKGKLILQVTSIDESGSLNVNVRQGLLKAREVVLVVTGANKREVVKKLYEENGK
SSFEPSDLKAHRMVTVVLDRAAAEGLPEDVKEYFTARFA
MAMNFKVFNDVEHVAEYTADIIRKQFNNNPTTIAGIHLTKDAAPVLDELKKDVDHNAVDFSQVNILDYDDNRSYYEALGV
PASQIYPINLDDDAESLIDDKIKTKENKGKLILQVTSIDESGSLNVNVRQGLLKAREVVLVVTGANKREVVKKLYEENGK
SSFEPSDLKAHRMVTVVLDRAAAEGLPEDVKEYFTARFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|