Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 890410..890942 | Replicon | chromosome |
| Accession | NZ_CP118979 | ||
| Organism | Staphylococcus haemolyticus strain DSM 20263 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | Q4L7V3 |
| Locus tag | PYW40_RS04270 | Protein ID | WP_011275272.1 |
| Coordinates | 890577..890942 (+) | Length | 122 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | Q4L7V4 |
| Locus tag | PYW40_RS04265 | Protein ID | WP_011275271.1 |
| Coordinates | 890410..890580 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYW40_RS04240 | 886196..886675 | + | 480 | WP_011275266.1 | PH domain-containing protein | - |
| PYW40_RS04245 | 886668..888191 | + | 1524 | WP_016931363.1 | PH domain-containing protein | - |
| PYW40_RS04250 | 888184..888711 | + | 528 | WP_016931364.1 | PH domain-containing protein | - |
| PYW40_RS04255 | 888721..889080 | + | 360 | WP_037559766.1 | holo-ACP synthase | - |
| PYW40_RS04260 | 889176..890324 | + | 1149 | WP_057504951.1 | alanine racemase | - |
| PYW40_RS04265 | 890410..890580 | + | 171 | WP_011275271.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| PYW40_RS04270 | 890577..890942 | + | 366 | WP_011275272.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PYW40_RS04275 | 891250..892251 | + | 1002 | WP_037559762.1 | PP2C family protein-serine/threonine phosphatase | - |
| PYW40_RS04280 | 892350..892676 | + | 327 | WP_011275274.1 | anti-sigma factor antagonist | - |
| PYW40_RS04285 | 892705..893157 | + | 453 | WP_046309853.1 | anti-sigma B factor RsbW | - |
| PYW40_RS04290 | 893132..893902 | + | 771 | WP_011275276.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13672.75 Da Isoelectric Point: 8.4121
>T273686 WP_011275272.1 NZ_CP118979:890577-890942 [Staphylococcus haemolyticus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYRLDKDSVILLEQIR
TLDKKRLKEKLTYLSDEKMQEVDEALDISLGLHDEVKTQNT
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYRLDKDSVILLEQIR
TLDKKRLKEKLTYLSDEKMQEVDEALDISLGLHDEVKTQNT
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2A1KA75 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2A1K7K7 |