Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /HTH_XRE(antitoxin) |
Location | 1048641..1049447 | Replicon | chromosome |
Accession | NZ_CP118976 | ||
Organism | Staphylococcus succinus strain DSM 14617 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | PYW31_RS05070 | Protein ID | WP_046836824.1 |
Coordinates | 1048641..1049105 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | PYW31_RS05075 | Protein ID | WP_046836823.1 |
Coordinates | 1049118..1049447 (-) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYW31_RS05015 | 1045118..1045675 | + | 558 | WP_046838001.1 | alpha/beta hydrolase | - |
PYW31_RS05060 | 1046921..1047985 | - | 1065 | WP_046836826.1 | site-specific integrase | - |
PYW31_RS05065 | 1048046..1048552 | - | 507 | WP_046836825.1 | hypothetical protein | - |
PYW31_RS05070 | 1048641..1049105 | - | 465 | WP_046836824.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
PYW31_RS05075 | 1049118..1049447 | - | 330 | WP_046836823.1 | helix-turn-helix transcriptional regulator | Antitoxin |
PYW31_RS05080 | 1049662..1049877 | + | 216 | WP_240621337.1 | helix-turn-helix transcriptional regulator | - |
PYW31_RS05085 | 1049919..1050800 | + | 882 | WP_046836821.1 | HNH endonuclease | - |
PYW31_RS05090 | 1050850..1051065 | + | 216 | WP_046836820.1 | DUF771 domain-containing protein | - |
PYW31_RS05095 | 1051079..1051252 | + | 174 | WP_156168127.1 | hypothetical protein | - |
PYW31_RS05100 | 1051316..1051537 | + | 222 | WP_046836846.1 | DUF2483 family protein | - |
PYW31_RS05105 | 1051530..1052144 | + | 615 | WP_046836819.1 | DUF1071 domain-containing protein | - |
PYW31_RS05110 | 1052147..1052560 | + | 414 | WP_046836818.1 | single-stranded DNA-binding protein | - |
PYW31_RS05115 | 1052573..1053241 | + | 669 | WP_046836817.1 | putative HNHc nuclease | - |
PYW31_RS05120 | 1053238..1053477 | + | 240 | WP_053042472.1 | helix-turn-helix transcriptional regulator | - |
PYW31_RS05125 | 1053479..1054261 | + | 783 | WP_046836816.1 | phage replisome organizer N-terminal domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1045118..1085872 | 40754 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17908.63 Da Isoelectric Point: 6.6975
>T273684 WP_046836824.1 NZ_CP118976:c1049105-1048641 [Staphylococcus succinus]
VGNYEQLLIANDNIKIKETNVLPEELGGININKIILLNSKNKHVNKIEILAEELAHYKITYGDIRDQTNMLNRKFELKAR
RLGCELAVSLDDIIEAFHHGVHNLYGIAEFLEVSEKYVLKVIEHYKMKYGLSTYHNGYVIKFEPLQVFEHRNLD
VGNYEQLLIANDNIKIKETNVLPEELGGININKIILLNSKNKHVNKIEILAEELAHYKITYGDIRDQTNMLNRKFELKAR
RLGCELAVSLDDIIEAFHHGVHNLYGIAEFLEVSEKYVLKVIEHYKMKYGLSTYHNGYVIKFEPLQVFEHRNLD
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|