Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 863747..864276 | Replicon | chromosome |
Accession | NZ_CP118976 | ||
Organism | Staphylococcus succinus strain DSM 14617 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A1S2MGJ9 |
Locus tag | PYW31_RS04030 | Protein ID | WP_046837772.1 |
Coordinates | 863914..864276 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A1S2MIN4 |
Locus tag | PYW31_RS04025 | Protein ID | WP_046837773.1 |
Coordinates | 863747..863917 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYW31_RS04000 | 859517..859996 | + | 480 | WP_046837778.1 | PH domain-containing protein | - |
PYW31_RS04005 | 859989..861491 | + | 1503 | WP_046837777.1 | PH domain-containing protein | - |
PYW31_RS04010 | 861484..861990 | + | 507 | WP_046837776.1 | PH domain-containing protein | - |
PYW31_RS04015 | 862045..862395 | + | 351 | WP_046837775.1 | holo-ACP synthase | - |
PYW31_RS04020 | 862511..863659 | + | 1149 | WP_046837774.1 | alanine racemase | - |
PYW31_RS04025 | 863747..863917 | + | 171 | WP_046837773.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
PYW31_RS04030 | 863914..864276 | + | 363 | WP_046837772.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PYW31_RS04035 | 864626..865627 | + | 1002 | WP_046837771.1 | PP2C family protein-serine/threonine phosphatase | - |
PYW31_RS04040 | 865707..866033 | + | 327 | WP_046837770.1 | anti-sigma factor antagonist | - |
PYW31_RS04045 | 866035..866517 | + | 483 | WP_046837769.1 | anti-sigma B factor RsbW | - |
PYW31_RS04050 | 866492..867262 | + | 771 | Protein_798 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13476.56 Da Isoelectric Point: 10.0960
>T273683 WP_046837772.1 NZ_CP118976:863914-864276 [Staphylococcus succinus]
MMRRGDVYLADLSPVQGSEQGGIRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKSKYKLDKDSVILLEQIR
TLDKNRLKEKLTYLSDDKMREVNNAIDISLGLHSVRTNKS
MMRRGDVYLADLSPVQGSEQGGIRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKSKYKLDKDSVILLEQIR
TLDKNRLKEKLTYLSDDKMREVNNAIDISLGLHSVRTNKS
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1S2MGJ9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1S2MIN4 |