Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 745480..746019 | Replicon | chromosome |
| Accession | NZ_CP118974 | ||
| Organism | Mammaliicoccus vitulinus strain DSM 15615 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A2T4PTI0 |
| Locus tag | PYW35_RS03675 | Protein ID | WP_016910942.1 |
| Coordinates | 745648..746019 (+) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A2T4PTG6 |
| Locus tag | PYW35_RS03670 | Protein ID | WP_016910943.1 |
| Coordinates | 745480..745647 (+) | Length | 56 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PYW35_RS03645 | 741367..741846 | + | 480 | WP_016910948.1 | PH domain-containing protein | - |
| PYW35_RS03650 | 741836..743347 | + | 1512 | WP_103322387.1 | PH domain-containing protein | - |
| PYW35_RS03655 | 743337..743819 | + | 483 | WP_016910946.1 | PH domain-containing protein | - |
| PYW35_RS03660 | 743831..744199 | + | 369 | WP_016910945.1 | holo-ACP synthase | - |
| PYW35_RS03665 | 744247..745395 | + | 1149 | WP_103322388.1 | alanine racemase | - |
| PYW35_RS03670 | 745480..745647 | + | 168 | WP_016910943.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| PYW35_RS03675 | 745648..746019 | + | 372 | WP_016910942.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PYW35_RS03680 | 746122..747126 | + | 1005 | WP_016910941.1 | PP2C family protein-serine/threonine phosphatase | - |
| PYW35_RS03685 | 747200..747523 | + | 324 | WP_016910940.1 | anti-sigma factor antagonist | - |
| PYW35_RS03690 | 747528..748004 | + | 477 | WP_016910939.1 | anti-sigma B factor RsbW | - |
| PYW35_RS03695 | 747979..748749 | + | 771 | WP_103322389.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13611.75 Da Isoelectric Point: 9.9193
>T273681 WP_016910942.1 NZ_CP118974:745648-746019 [Mammaliicoccus vitulinus]
MRRGDVYLADLSPVTGSEQGGTRPVVIIQNDTGNRYSPTVIVAAITGKINKAKIPTHVEIEAAKYKLDRDSVILLEQIRT
IDKKRLKEKLTYLSDAKMKEVDTAIAISLNLTLQQKFDALGNT
MRRGDVYLADLSPVTGSEQGGTRPVVIIQNDTGNRYSPTVIVAAITGKINKAKIPTHVEIEAAKYKLDRDSVILLEQIRT
IDKKRLKEKLTYLSDAKMKEVDTAIAISLNLTLQQKFDALGNT
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2T4PTI0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2T4PTG6 |