Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1909195..1909657 Replicon chromosome
Accession NZ_CP118973
Organism Staphylococcus warneri strain DSM 20316

Toxin (Protein)


Gene name TsaT Uniprot ID A0A2V3ZEQ2
Locus tag PYW39_RS09395 Protein ID WP_002465948.1
Coordinates 1909472..1909657 (+) Length 62 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID A0A364UQZ8
Locus tag PYW39_RS09390 Protein ID WP_015365250.1
Coordinates 1909195..1909452 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PYW39_RS09350 1904403..1904726 + 324 WP_015365247.1 thioredoxin family protein -
PYW39_RS09355 1904838..1905377 - 540 WP_002465937.1 nitroreductase -
PYW39_RS09360 1905455..1906171 - 717 WP_002465941.1 type I 3-dehydroquinate dehydratase -
PYW39_RS09365 1906347..1906769 + 423 WP_002450862.1 organic hydroperoxide resistance protein -
PYW39_RS09370 1907047..1907541 + 495 WP_002465942.1 GNAT family N-acetyltransferase -
PYW39_RS09375 1907674..1908264 - 591 WP_002465945.1 histidine phosphatase family protein -
PYW39_RS09380 1908473..1908706 + 234 WP_002450865.1 hypothetical protein -
PYW39_RS09385 1908698..1908901 - 204 WP_015365249.1 sterile alpha motif-like domain-containing protein -
PYW39_RS09390 1909195..1909452 + 258 WP_015365250.1 hypothetical protein Antitoxin
PYW39_RS09395 1909472..1909657 + 186 WP_002465948.1 hypothetical protein Toxin
PYW39_RS09400 1909863..1910339 + 477 WP_002465936.1 lipoprotein N-acylation protein LnsA -
PYW39_RS09405 1910399..1910632 - 234 WP_002450870.1 hypothetical protein -
PYW39_RS09410 1910897..1911649 + 753 WP_002465946.1 poly-gamma-glutamate hydrolase family protein -
PYW39_RS09415 1911740..1912024 + 285 WP_002465939.1 hypothetical protein -
PYW39_RS09420 1912102..1912317 + 216 WP_002465949.1 hypothetical protein -
PYW39_RS09425 1912782..1913021 + 240 WP_002465943.1 hypothetical protein -
PYW39_RS09430 1913250..1913483 + 234 WP_015365252.1 hypothetical protein -
PYW39_RS09435 1913658..1913858 - 201 WP_103286258.1 cold-shock protein -
PYW39_RS09440 1914179..1914544 - 366 WP_002466279.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 62 a.a.        Molecular weight: 6977.68 Da        Isoelectric Point: 10.1605

>T273679 WP_002465948.1 NZ_CP118973:1909472-1909657 [Staphylococcus warneri]
MSLHFTILFWLSLIFIVAGAIILAIMLKTKKESKKESYLGFTIVFFIFGLAMLIYTLLFGL

Download         Length: 186 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9908.17 Da        Isoelectric Point: 4.5910

>AT273679 WP_015365250.1 NZ_CP118973:1909195-1909452 [Staphylococcus warneri]
MKLYIIHAINIILTILFIIFNVIITYNANLDDTLWLVPGLIVCGLIMMISFAIAITKKDLLSEVLFFINIILTLYYIYPI
FYDFL

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2V3ZEQ2

Antitoxin

Source ID Structure
AlphaFold DB A0A364UQZ8

References