Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 811199..811728 | Replicon | chromosome |
Accession | NZ_CP118973 | ||
Organism | Staphylococcus warneri strain DSM 20316 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A2T4PXE7 |
Locus tag | PYW39_RS03985 | Protein ID | WP_002451625.1 |
Coordinates | 811366..811728 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A2T4PXF4 |
Locus tag | PYW39_RS03980 | Protein ID | WP_002451626.1 |
Coordinates | 811199..811369 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYW39_RS03955 | 807024..807497 | + | 474 | WP_002466763.1 | PH domain-containing protein | - |
PYW39_RS03960 | 807490..809016 | + | 1527 | WP_164553444.1 | PH domain-containing protein | - |
PYW39_RS03965 | 809003..809506 | + | 504 | WP_015364833.1 | PH domain-containing protein | - |
PYW39_RS03970 | 809533..809907 | + | 375 | WP_002466788.1 | holo-ACP synthase | - |
PYW39_RS03975 | 809959..811107 | + | 1149 | WP_015364834.1 | alanine racemase | - |
PYW39_RS03980 | 811199..811369 | + | 171 | WP_002451626.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
PYW39_RS03985 | 811366..811728 | + | 363 | WP_002451625.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PYW39_RS03990 | 812051..813052 | + | 1002 | WP_002466762.1 | PP2C family protein-serine/threonine phosphatase | - |
PYW39_RS03995 | 813146..813472 | + | 327 | WP_002466754.1 | anti-sigma factor antagonist | - |
PYW39_RS04000 | 813474..813953 | + | 480 | WP_049414624.1 | anti-sigma B factor RsbW | - |
PYW39_RS04005 | 813928..814698 | + | 771 | WP_002451621.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13562.68 Da Isoelectric Point: 9.9783
>T273675 WP_002451625.1 NZ_CP118973:811366-811728 [Staphylococcus warneri]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKNRLKEKLTYLSDNKMKEVDYALDISLGLHNFNHSKT
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKNRLKEKLTYLSDNKMKEVDYALDISLGLHNFNHSKT
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2T4PXE7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2T4PXF4 |