Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 202666..203194 Replicon plasmid unnamed1
Accession NZ_CP118964
Organism Acinetobacter lwoffii strain DSM 2403

Toxin (Protein)


Gene name relE Uniprot ID N9N871
Locus tag PYW33_RS16320 Protein ID WP_000221358.1
Coordinates 202901..203194 (+) Length 98 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID N9NWT9
Locus tag PYW33_RS16315 Protein ID WP_000246755.1
Coordinates 202666..202911 (+) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PYW33_RS16290 197795..198059 + 265 Protein_216 hypothetical protein -
PYW33_RS16295 198113..198817 - 705 WP_023278713.1 IS6-like element IS1008 family transposase -
PYW33_RS16300 199419..201230 + 1812 WP_004733211.1 copper resistance system multicopper oxidase -
PYW33_RS16305 201217..201555 + 339 WP_004897649.1 hypothetical protein -
PYW33_RS16310 201542..202486 + 945 WP_004668309.1 copper resistance protein B -
PYW33_RS16315 202666..202911 + 246 WP_000246755.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
PYW33_RS16320 202901..203194 + 294 WP_000221358.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PYW33_RS16325 203324..203653 - 330 WP_004733205.1 four-helix bundle copper-binding protein -
PYW33_RS16330 204432..204788 + 357 WP_000269911.1 type II toxin-antitoxin system RelE/ParE family toxin -
PYW33_RS16335 204781..205083 + 303 WP_001140620.1 XRE family transcriptional regulator -
PYW33_RS16340 205125..205286 - 162 Protein_226 IS6 family transposase -
PYW33_RS16345 205339..205773 + 435 Protein_227 recombinase family protein -
PYW33_RS16350 205784..206773 + 990 WP_130908661.1 arsenic resistance protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..221373 221373


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(8-84)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-72)


Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11292.52 Da        Isoelectric Point: 10.4753

>T273672 WP_000221358.1 NZ_CP118964:202901-203194 [Acinetobacter lwoffii]
MTYKLLRHKDFTAEWEKLPVAIRDQFKKKLAKVIEQPHIPKNMLRGDLAGCYKIKLLKAGVRLVYQVKDDQVVILLITVG
KRADSIVYDEAKKRIKD

Download         Length: 294 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 9249.64 Da        Isoelectric Point: 4.3142

>AT273672 WP_000246755.1 NZ_CP118964:202666-202911 [Acinetobacter lwoffii]
MATVNFRIDEALKEKSYSILKEQGIAPTDFFTSILEYVATTGKLPVKKALLSEEDEELLALVRKRINDPKEMFEEVTLDD
L

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6A1RKP4

Antitoxin

Source ID Structure
AlphaFold DB A0A6A1RJ80

References