Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/upstrm_HI1419-dnstrm_HI1420
Location 152906..153494 Replicon plasmid unnamed1
Accession NZ_CP118964
Organism Acinetobacter lwoffii strain DSM 2403

Toxin (Protein)


Gene name relE Uniprot ID N9CKJ9
Locus tag PYW33_RS16040 Protein ID WP_004647749.1
Coordinates 153198..153494 (-) Length 99 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag PYW33_RS16035 Protein ID WP_004647750.1
Coordinates 152906..153196 (-) Length 97 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PYW33_RS15995 148269..148886 + 618 WP_004647761.1 hypothetical protein -
PYW33_RS16000 148999..149538 - 540 WP_252509242.1 IS630 family transposase -
PYW33_RS16005 149555..150010 - 456 WP_004647755.1 helix-turn-helix domain-containing protein -
PYW33_RS16010 150168..150461 - 294 WP_004647759.1 type II toxin-antitoxin system RelE/ParE family toxin -
PYW33_RS16015 150451..150696 - 246 WP_000246755.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
PYW33_RS16020 150838..151728 - 891 WP_035334907.1 LysR family transcriptional regulator -
PYW33_RS16025 151878..152471 + 594 WP_004647752.1 NAD(P)H-dependent oxidoreductase -
PYW33_RS16030 152481..152795 + 315 WP_004647751.1 putative quinol monooxygenase -
PYW33_RS16035 152906..153196 - 291 WP_004647750.1 putative addiction module antidote protein Antitoxin
PYW33_RS16040 153198..153494 - 297 WP_004647749.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PYW33_RS16045 153587..154564 - 978 WP_016807245.1 helix-turn-helix domain-containing protein -
PYW33_RS16050 154697..155581 + 885 WP_023278701.1 MBL fold metallo-hydrolase -
PYW33_RS16055 155665..156207 + 543 WP_016807230.1 cysteine hydrolase family protein -
PYW33_RS16060 156294..156575 - 282 WP_000985610.1 putative addiction module antidote protein -
PYW33_RS16065 156576..156782 - 207 Protein_171 type II toxin-antitoxin system RelE/ParE family toxin -
PYW33_RS16070 156847..157551 + 705 WP_023278702.1 IS6-like element IS1008 family transposase -
PYW33_RS16075 157606..157758 + 153 Protein_173 IS5/IS1182 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..221373 221373


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(3-95)

Antitoxin

Uncharacterized protein HI1420

(9-94)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11584.25 Da        Isoelectric Point: 5.8801

>T273671 WP_004647749.1 NZ_CP118964:c153494-153198 [Acinetobacter lwoffii]
MIEIKRLPEFDEWLDGIKDNMTRIRLNRRLDKVQRGNWGDIKPLQDGVWEMREFFGSGWRMYYIQHGDVVIVMLGGGDKS
TQQQDIDRAVKLSKTLED

Download         Length: 297 bp

Antitoxin


Download         Length: 97 a.a.        Molecular weight: 10515.17 Da        Isoelectric Point: 5.6158

>AT273671 WP_004647750.1 NZ_CP118964:c153196-152906 [Acinetobacter lwoffii]
MVKVADLPSFDMAESLKTEEDIVIYLNMVLEENDPAELAHALGVIAKARGMTQIAKEAGIGREALYKALRHDSAPRFDTI
NRVVNALGLKLTVQHA

Download         Length: 291 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References